KEGG   Saccharomyces cerevisiae (budding yeast): YBR052C
Entry
YBR052C           CDS       T00005                                 
Symbol
RFS1
Name
(RefSeq) flavodoxin-like fold family protein
  KO
K03809  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00130  Ubiquinone and other terpenoid-quinone biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    YBR052C (RFS1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     YBR052C (RFS1)
SSDB
Motif
Pfam: FMN_red 5_3_exonuc_N
Other DBs
NCBI-GeneID: 852341
NCBI-ProteinID: NP_009608
SGD: S000000256
UniProt: P38234
Position
II:complement(338720..339352)
AA seq 210 aa
MPKVAILIYSVDDIIATLAENEKKGIEIAGGEAEIFQVPDVSYKTEYATEEGKEAAKVAK
TNADFSYKILTRETLVEYDYYLFGIPTKFGNFPAEWKSFWDSNTGGLWAKGSLHGKIAGL
FVSGAISGKGDTEMCIMNAMSTLVHHGVIYVPLGYKNAYKELTDVEDVNGSCAWGAGCVS
GIDGGRPPSLSELRVHQLQGKAFYDRIKDL
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgaaagtcgctattttgatttattcagtggacgatataattgccacattagcagaa
aatgaaaaaaaaggtatagagatagctggtggtgaggctgagattttccaagtgccagac
gtcagctataaaactgaatatgcgacagaagagggaaaagaggcagccaaagtcgccaaa
actaatgcagatttttcctataaaatcctaacaagagaaacgttggttgagtacgattac
tacttattcggaatacctactaagtttggaaacttccccgcggagtggaaaagcttttgg
gactcgaatactggtgggctttgggcaaagggttctctccatggcaaaattgccggtttg
tttgtttcaggcgcaataagcggcaagggtgatacagaaatgtgtatcatgaacgcaatg
agtactctggtccatcatggtgtcatttatgtcccattggggtataagaacgcatacaag
gaattgaccgacgttgaagatgtgaacgggtcttgcgcctggggcgcaggatgtgtttct
ggaatcgacggtggcagacctcccagtttatccgagctaagagttcaccaacttcaaggg
aaggccttttacgaccgtatcaaagatttgtaa

DBGET integrated database retrieval system