KEGG   Saccharomyces cerevisiae (budding yeast): YBR259W
Entry
YBR259W           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: DUF5704
Other DBs
NCBI-GeneID: 852562
NCBI-ProteinID: NP_009818
SGD: S000000463
UniProt: P38338
Position
II:730387..732453
AA seq 688 aa
MSIDEAVARYRDVIGNLATGNLRRIVIQSEKLAQIIASSKGTVRFHHKTRSGKTVIYKCI
KKALLSSVASLSSEFSSETDVQQFLHLNYIYQSHFQALSGQINKYCGMKKYYELKFAAID
YLETEVQTTGLTLSRFWVASLDEFIKKERWPDNGSNFQIFYKLMAEYSSWKWDSDDKRQL
QFMYEFRMKLKECLVKFYENFDLQKSSDPLKELIIPWEKIVYVANCIDAFTGEQVRIDGA
ELIWTSKNLVFSSISSAVLRLNDLQNMFSAFRPYGEEALVQDFAHIRSLKWDSNDKVESL
IRALIFNDMFPYFNKEQVDTKADGIFFLRLLRKNFKEHINDVKDFHIQVIKYLNSQFKNN
YSTLMTSSKTQDRRKSHNMPSSILDDGNKIGMHVSPIDEYSHFIDNDEPLWRDKVYPKIY
TNEQTPTPDASAIFDSHKIYAIISLLRYYLPEKRKFFRIYYLPSIFKRILYYGAKFAQLY
FMEGCLERLVIESLQILEPSLVHAINNLIKSSIESLKNVTVTSDDKTSSGVIILSYKEFK
SLSEVNKDFNEPFWPNQSIANSWPDFANKQLKRGQILQDAFAFHLFEIELPIIIDTTRNT
HLKLVSNMCTTSILYLYNEVDSLSLTSIQEKLAVLPTSKRNEILLYNLNRLTKLKLLLLK
ENEKGQKFYAFNFKYKRDGQKTSLIRLI
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtccattgacgaggctgttgccagatatagagatgttataggcaatctagcaactggc
aatttaaggcggattgttatacagtcagaaaaactggcccagatcattgcatcttcaaaa
ggtaccgttcgtttccaccataaaactcgcagcggtaaaacagtaatatacaaatgcatc
aaaaaggcgctgctttccagtgtcgcgtctctatcgtcagagttttcctcagaaacagat
gttcagcaattcctccatttaaattacatatatcaatctcacttccaagctttgagtgga
caaataaacaaatattgcggcatgaagaaatactacgagttaaagtttgcagcaatcgac
tacttagaaaccgaagtccaaactaccgggcttacactctcaagattctgggtggcatct
ttagatgagttcattaaaaaagagcgatggccagataatggatctaactttcaaatcttt
tacaaactaatggctgagtattcgtcttggaaatgggattctgatgataaaaggcaactc
cagttcatgtacgaatttcgaatgaaactcaaagaatgtttggtgaaattttacgagaat
tttgatcttcaaaaatctagcgatcctctgaaagaactcattataccttgggaaaagatt
gtttatgtcgccaactgtatcgatgcattcactggagagcaagttaggatcgacggtgct
gaattaatctggacatccaaaaatcttgtgttctcttcgatttcttctgccgttcttaga
ttaaatgaccttcaaaatatgttcagcgcattccggccttatggggaagaagcattagtt
caagactttgcgcatatacgatctttaaagtgggatagtaatgataaagttgaaagctta
attcgtgcccttatttttaatgatatgtttccttatttcaataaggaacaggtagatacg
aaggcagatggtatattctttttgcgcttactgagaaaaaacttcaaagaacacattaat
gacgttaaagattttcatattcaagtgataaagtacttgaattcccaatttaaaaataat
tacagcacattgatgacgtcatcgaaaactcaggatagaaggaaaagtcataatatgcct
tcttctatcttagacgatggtaacaaaattggaatgcatgtttcgcctatcgatgaatac
tcacattttattgataatgatgaaccgttgtggcgagacaaagtatatccaaagatttac
acaaatgagcaaacacctacacctgacgcatcagcaatatttgattctcacaagatatat
gcaattatatcgctgctgcgatattacttacctgagaagagaaagttttttcggatttat
tatctgcccagtatttttaaaaggatattatattacggtgcaaagtttgctcaactatat
ttcatggaaggttgcttggaacggctagtaatagaatctctccaaattctagaaccctct
ttggtacatgcgataaataatttgatcaagtctagcatagaatcactcaaaaatgtaaca
gtgacaagtgatgacaaaacttcatctggtgtcattattttgtcctacaaagaatttaag
tcactatctgaagttaacaaagatttcaatgaaccattttggcctaaccaatcaattgcg
aatagttggccagatttcgcgaataagcaattaaagaggggtcaaattttgcaagacgca
tttgcattccacctttttgaaattgaactaccaattattatcgatactacaagaaatacg
catttgaaactcgtttccaacatgtgtactacgagcatattgtacttatataatgaagtt
gattccttatcattaactagcatacaggaaaaattagctgttttaccgacaagtaaacgg
aatgaaatcttattgtacaatttgaacaggctaacaaaattgaaactattgttgttgaaa
gagaacgaaaaaggacaaaagttttacgcatttaattttaagtacaaaagggatggacag
aaaacatcattaataaggttaatttaa

DBGET integrated database retrieval system