KEGG   Saccharomyces cerevisiae (budding yeast): YCR023C
Entry
YCR023C           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12
Other DBs
NCBI-GeneID: 850387
NCBI-ProteinID: NP_009952
SGD: S000000617
UniProt: P25351
Position
III:complement(158538..160373)
AA seq 611 aa
MARQKLTFKEQMDGFPWVQLVVVSLVRFSEPIAFSSLFPYVYFMVRDFNIAPNDAQVSKY
SGYLSSSFALCQVISAYHWGRFSEKHGRKITLTCGLIGTSVSLLILGFSRNFYQALVARS
LMGLLNGNVGVIRTIIGEIATERKHQALAFSTMPLLFQFGAVVGPMIGGFLVFRDGTMNE
VPLWFPHFAKRIIRSYPYALPNVVVCMFLMFGLTNATLFLEETHPAFKDRRDYGLEVGDF
IKKNIFGIQPKRRPWQKRIQDDSENIHHRNENVNSIRGQDSEEDENSPLVNTTNDDDTES
IQSIDPILTRRQSVGLIRTYSLHEPTDAVHANIDTAPDGCKESSIFHHVFHTKVFYPISV
NFIMALHLIVYNEFLPVFLAYDLAVDPENPKKLASKFPWKISGGIGYEPEQTGTLLSTTG
IFGCFVVIFIFPIVDRNFDCLTIFRTLVKLYPIMYVMVPYVVFLQNERIPSWYTVVYLYI
ITGIKTFCGALTSPQIMLLIHNSSPLSCRSVINGATISISASARFIGPLVWGYIMSWSQQ
NDVAWVSWWSLSLFCMVALYQSYKIAPIDDNENELHGQGSEDAYNSQSQSSDLRMAHRSS
LSSLSNQRCTT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggcgcgtcaaaagcttactttcaaagaacaaatggatggtttcccctgggtccaactt
gttgttgtgtccttagttaggttcagcgaaccaattgcgttttcgtcactatttccttat
gtttatttcatggttagagattttaatattgctcccaatgatgctcaagtgtccaaatat
tcaggttatttatcttcatcatttgcgttatgccaagtcatatctgcgtaccactggggt
agattctctgaaaagcatggcagaaaaataacattgacttgcgggcttataggaacatct
gtatcattgttaatactgggattttcacgcaatttctatcaggctttggtggcaagaagt
ttaatgggattgctaaatggtaacgtcggcgttattagaaccattattggtgaaatagca
actgaaagaaaacatcaggctttagctttcagtactatgcctttattatttcaatttggt
gccgttgttgggcctatgatcggtgggtttcttgtatttagagatggaacaatgaatgaa
gtgccactatggtttccacattttgcaaaaagaataattaggtcatatccgtacgccttg
ccaaacgtggtagtgtgcatgtttttgatgtttggtttaactaatgcaacattgtttttg
gaagaaacacatcctgcttttaaagatagaagagattacggtttagaggtcggtgatttt
attaagaagaatatatttggtatacagccgaaaagaagaccctggcaaaagcgcattcag
gatgattcggaaaacattcaccaccgtaatgagaatgtgaacagcattcgaggacaagat
agtgaagaggatgaaaatagtcccctagtgaatactaccaatgacgatgatactgaaagc
atacaatcgattgatcctattttaacaagaagacagtctgtaggcctgattaggacatat
tctctgcatgaaccaacagacgctgtgcatgccaatatagatacagctccagacggttgt
aaagaaagtagtatatttcatcacgtttttcatacaaaagtattttaccctatatcggtg
aattttattatggctttacatttgattgtatacaacgaatttttgcctgtttttttagct
tatgatttagccgtagatccagaaaatccaaagaagctggcttcaaaatttccgtggaaa
atatctggcggtataggttatgaaccagaacaaaccggtactcttttgtcgacaacaggt
atctttggttgttttgtggttattttcatttttcccatagttgatcgaaatttcgattgt
ttaacaattttcagaactttagtcaagctgtaccctattatgtacgttatggttccttac
gttgtttttctacagaatgaacggattcctagctggtatactgtcgtctacttgtacata
atcacagggataaaaacattttgtggcgctttaacgtcaccacaaattatgttattaatt
cataattcgagtcccttgagttgtagatcagtcatcaatggcgccaccattagtatttct
gcctctgctcgtttcataggtcccttagtatggggctatattatgtcttggtcccagcaa
aatgacgtcgcctgggtcagttggtggtcgttaagtcttttttgtatggtagctctttat
caaagttataagatagcaccaattgatgataacgaaaatgagcttcatggacagggtagt
gaagatgcctacaattcgcagtcacagtcttctgatttaagaatggctcatcgatctagt
ttaagcagcttaagtaaccaacgctgtaccacatga

DBGET integrated database retrieval system