KEGG   Saccharomyces cerevisiae (budding yeast): YCR105W
Entry
YCR105W           CDS       T00005                                 
Symbol
ADH7, ADHVII
Name
(RefSeq) NADP-dependent alcohol dehydrogenase
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00040  Pentose and glucuronate interconversions
sce00053  Ascorbate and aldarate metabolism
sce00561  Glycerolipid metabolism
sce00620  Pyruvate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YCR105W (ADH7)
   00040 Pentose and glucuronate interconversions
    YCR105W (ADH7)
   00053 Ascorbate and aldarate metabolism
    YCR105W (ADH7)
   00620 Pyruvate metabolism
    YCR105W (ADH7)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    YCR105W (ADH7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YCR105W (ADH7)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     YCR105W (ADH7)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YCR105W (ADH7)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 AlaDh_PNT_C GFO_IDH_MocA
Other DBs
NCBI-GeneID: 850469
NCBI-ProteinID: NP_010030
SGD: S000000702
UniProt: P25377
Position
III:309070..310155
AA seq 361 aa
MLYPEKFQGIGISNAKDWKHPKLVSFDPKPFGDHDVDVEIEACGICGSDFHIAVGNWGPV
PENQILGHEIIGRVVKVGSKCHTGVKIGDRVGVGAQALACFECERCKSDNEQYCTNDHVL
TMWTPYKDGYISQGGFASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRNGCGP
GKRVGIVGIGGIGHMGILLAKAMGAEVYAFSRGHSKREDSMKLGADHYIAMLEDKGWTEQ
YSNALDLLVVCSSSLSKVNFDSIVKIMKIGGSIVSIAAPEVNEKLVLKPLGLMGVSISSS
AIGSRKEIEQLLKLVSEKNVKIWVEKLPISEEGVSHAFTRMESGDVKYRFTLVDYDKKFH
K
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgctttacccagaaaaatttcagggcatcggtatttccaacgcaaaggattggaagcat
cctaaattagtgagttttgacccaaaaccctttggcgatcatgacgttgatgttgaaatt
gaagcctgtggtatctgcggatctgattttcatatagccgttggtaattggggtccagtc
ccagaaaatcaaatccttggacatgaaataattggccgcgtggtgaaggttggatccaag
tgccacactggggtaaaaatcggtgaccgtgttggtgttggtgcccaagccttggcgtgt
tttgagtgtgaacgttgcaaaagtgacaacgagcaatactgtaccaatgaccacgttttg
actatgtggactccttacaaggacggctacatttcacaaggaggctttgcctcccacgtg
aggcttcatgaacactttgctattcaaataccagaaaatattccaagtccgctagccgct
ccattattgtgtggtggtattacagttttctctccactactaagaaatggctgtggtcca
ggtaagagggtaggtattgttggcatcggtggtattgggcatatggggattctgttggct
aaagctatgggagccgaggtttatgcgttttcgcgaggccactccaagcgggaggattct
atgaaactcggtgctgatcactatattgctatgttggaggataaaggctggacagaacaa
tactctaacgctttggaccttcttgtcgtttgctcatcatctttgtcgaaagttaatttt
gacagtatcgttaagattatgaagattggaggctccatcgtttcaattgctgctcctgaa
gttaatgaaaagcttgttttaaaaccgttgggcctaatgggagtatcaatctcaagcagt
gctatcggatctaggaaggaaatcgaacaactattgaaattagtttccgaaaagaatgtc
aaaatatgggtggaaaaacttccgatcagcgaagaaggcgtcagccatgcctttacaagg
atggaaagcggagacgtcaaatacagatttactttggtcgattatgataagaaattccat
aaatag

DBGET integrated database retrieval system