KEGG   Saccharomyces cerevisiae (budding yeast): YCR107W
Entry
YCR107W           CDS       T00005                                 
Symbol
AAD3
Name
(RefSeq) putative aryl-alcohol dehydrogenase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 850471
NCBI-ProteinID: NP_010032
SGD: S000000704
UniProt: P25612
Position
III:313890..314981
AA seq 363 aa
MIGSASDSSSKLGRLRFLSETAAIKVSPLILGEVSYDGARSDFLKSMNKNRAFELLDTFY
EAGGNFIDAANNCQNEQSEEWIGEWIQSRRLRDQIVIATKFIKSDKKYKAGESNTANYCG
NHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEFMDSLHILVQQGKVLYLGVSDT
PAWVVSAANYYATSYGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRF
QSKKAMEERRKNGEGIRSFVGASEQTDAEIKISEALAKIAEEHGTESVTAIAIAYVRSKA
KNFFPSVEGGKIEDLKENIKALSIDLTPDNIKYLESIVPFDIGFPNNFIVLNSLTQKYGT
NNV
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgattgggtccgcgtccgactcatctagcaagttaggacgcctccgatttctttctgaa
actgccgctattaaagtatccccgttaatcctaggagaagtctcatacgatggagcacgt
tcggattttctcaaatcaatgaacaagaatcgagcttttgaattgcttgatactttttac
gaggcaggtggaaatttcattgatgccgcaaacaactgccaaaacgagcaatcagaagaa
tggattggtgaatggatacagtccagaaggttacgtgatcaaattgtcattgcaaccaag
tttataaaaagcgataaaaagtataaagcaggtgaaagtaacactgccaactactgtggt
aatcacaagcgtagtttacatgtgagtgtgagggattctctccgcaaattgcaaactgat
tggattgatatactttacgttcactggtgggattatatgagttcaatcgaagaatttatg
gatagtttgcatattctggtccagcagggcaaggtcctctatttgggtgtatctgataca
cctgcttgggttgtttctgcggcaaactactacgctacatcttatggtaaaactcccttt
agtatctaccaaggtaaatggaacgtgttgaacagagattttgagcgtgatattattcca
atggctaggcatttcggtatggccctcgccccatgggatgtcatgggaggtggaagattt
cagagtaaaaaagcaatggaggaacggaggaagaatggagagggtattcgttctttcgtt
ggcgcctccgaacaaacagatgcagaaatcaagattagtgaagcattggccaagattgct
gaggaacatggcactgagtctgttactgctattgctattgcctatgttcgctctaaggcg
aaaaatttttttccgtcggttgaaggaggaaaaattgaggatctcaaagagaacattaag
gctctcagtatcgatctaacgccagacaatataaaatacttagaaagtatagttcctttt
gacatcggatttcctaataattttatcgtgttaaattccttgactcaaaaatatggtacg
aataatgtttag

DBGET integrated database retrieval system