KEGG   Saccharomyces cerevisiae (budding yeast): YDL091C
Entry
YDL091C           CDS       T00005                                 
Symbol
UBX3
Name
(RefSeq) Ubx3p
  KO
K18726  FAS-associated factor 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL091C (UBX3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YDL091C (UBX3)
SSDB
Motif
Pfam: UBX
Other DBs
NCBI-GeneID: 851467
NCBI-ProteinID: NP_010192
SGD: S000002249
UniProt: Q12229
Position
IV:complement(293392..294759)
AA seq 455 aa
MDIFRHTFGNNDDSFIRIPGAFREEPPADLNGRTEDQNSNTNEPTQSRDGRLKSILHFLF
QAPLIVLYYLLNFIVRSSRLLKPLLRLHGFYQRKHNRLLDHSSQLHRLLENLENEAQAVT
CSEGNGNNDDGSNTDSTSNNESSGVQFSFGSLYNPENGTFSKSIMQNSYTELLDACSEQV
KFGVIYLHDPLLDNHMDYVNKILCSEAFVNMIRKYQVLLWYGDVTTSEGLQVSNALKIRQ
YPLLGIISLKAEKKIELIARVEGSISNYKAQDLEAIFSKNYSRLIQLRQQRQNIEMQRLI
RQQQDSRYQDSLRRDQQRESERLEQTQREQMEREHQRIENQWLLWRKSQLKPEPSSDKDA
SKVAIRLENGQRLVRKFDASLPTEEIYAFVELQLHDMLNSENDTLPVYQPANYQHQYSFK
LITPVPRRELDLSTKISDVSGIYPSGNIVMERLDE
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggatatatttaggcatacttttggaaataatgatgattcctttattcgaatcccaggt
gcttttagagaagaaccacctgctgatttgaatggaaggacagaagatcaaaacagcaat
acaaatgaacccacacagagccgggatggacgcttaaaatcaatactccattttttattt
caagctcccctaatagttctttattatttattgaatttcattgtccgaagttcacgtctt
ttaaaacctctattaagacttcacggattctaccagaggaagcacaaccgtttactagac
cacagttcccaattacaccgtcttttagaaaatctagaaaacgaagctcaagctgtaacg
tgttctgaaggtaacgggaataatgatgatggcagcaatactgacagtacgagcaacaat
gagagcagtggggtccagtttagttttggttctttatacaaccctgaaaatggaacattt
tccaaaagcattatgcaaaatagttacactgaattattggatgcttgtagcgaacaagtg
aaatttggagtcatttatttacatgacccattgttggataatcatatggattacgttaat
aaaatattgtgctcagaagcctttgttaacatgataaggaagtaccaggtattactatgg
tatggtgacgttactacatccgaggggttgcaagtttccaatgcattaaaaattaggcaa
tatcccctacttggaataatttctttaaaggctgagaaaaaaatagagttaatagcaaga
gttgaaggttctatttctaactacaaagcccaagatttggaggccatattctccaagaat
tattctcgattaattcaattgcgtcagcaaagacaaaatattgaaatgcagagattaata
agacaacaacaggattcaagataccaggattccttaagacgtgatcaacaaagagaatca
gaaagattggaacagacccaaagagaacaaatggaaagagagcaccaaagaatagaaaac
caatggctattgtggagaaaaagccaactaaaacccgaaccctcttctgataaagatgca
agcaaagttgcgatcagactagaaaatgggcagagattagtgagaaagtttgacgcatct
ctaccaacggaggagatatatgccttcgtagaattacagttgcatgacatgttgaactca
gaaaacgatactttacccgtataccaacctgctaattatcagcaccagtatagcttcaaa
ttgatcacgccggtaccaagaagagagcttgatttatctaccaaaatatctgacgttagc
ggcatatatccatcaggaaatattgtaatggaacgcctggacgaatga

DBGET integrated database retrieval system