KEGG   Saccharomyces cerevisiae (budding yeast): YDR089W
Entry
YDR089W           CDS       T00005                                 
Symbol
VTC5
Name
(RefSeq) Vtc5p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Saf_2TM
Other DBs
NCBI-GeneID: 851663
NCBI-ProteinID: NP_010374
SGD: S000002496
UniProt: P38966
Position
IV:622112..624721
AA seq 869 aa
MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF
QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ
LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD
LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR
SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI
ISTSKEILDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVSISIL
DTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDVKNIL
SAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISADNGDIY
LIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKSVVTNEFQCSLI
PPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLT
GPINNSQGSVDSGRRVRIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSR
STTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPH
CSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLT
SCIMASVCLGIVLSLFRGQSNNEIDLEIQNILIAIIIISLLVSLILICACLLLLFSRFTL
APIWHYVGCFTMFFSVTGTVCYGMIEIFF
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgaaatttgaagatcgcatattgaataaatcaatccctgaatggaaattctacaatatt
aactatgagaagttaaaagtagccataaaaaaagtaacggcttatgattatgacaatcca
aatgattcgggcatggagaagttgttgaatcaatgttcagtagcctttgaccaggaattt
caaaatgttaatttatttgtttctttgaaaataaaggaaatttccactcgtattctttct
gtggaatcatcaataatcgatttttcaaagggcttaaacaaaacttccagaaaccgtttc
aaccttcgtaaactgaaaatcatcaacgctcatgtagacgattgtaactttgaactacaa
ctactgtcaaggtttttgataatacaaaggattgccttgagaaagttattcaaaaaatta
ctaaatgaatttcctcaagacagtgaaaatccattgactgcaagtgagtatgttacgtcg
atcagaaactctgaaagtttacgaaatggacacgaaggcatatcatttatgaagcttgat
ttagatccatatcttttagaagtttcgctaattgttgatgttttacatgatttggaaaat
aaacttgaagatgcaactgagccagcagtggagcaaagatccctaaaccgctccgatgaa
tctgcccatacaagttcaagtccagaagccaacaattcttccttgccagcatctccaagg
tcaattccgctactttcaaacaagaaaacttcaaaaatgattgattcttcgctagaattc
gatactgccctcatagataaagcagagaatctaggaaggtttttattatcgtccgaggac
atagagggactgaagttcatgctattgaatattggttttaggataattgacgatagcatc
atatccacttcaaaggagattttagacactacagataatattaattctgcgggcaacaaa
tctataagatcagcaaagtcattcaatgacttacaacataccttatccctatctaaacag
aagaacatattaccctctgctgtacaatccaatgagaagtacgtttctattagtatacta
gatactgtcgggaacgaaggcagtcctttactacttactgatgataatataaatcagcac
ccaaacatgatagtcagctctactgctgaggatacttgtatagtaatgtgccacgtgggc
ggcttaagaaatcatgttgtcacaaatgatctgcttctaagggatgtaaagaatattctt
tcggccatgaggagtggcaacgacacaaaaaatattagcgctctcataaactcactggat
ccatcgccaatcagtaagatcgctttggagtggattcagtcccatcgattaaaaaccatt
gaaccaaagctagattttaaaagaacaagattcatatcagcagacaatggagatatatac
ttgatagctttggatgaatctatcactattggaaatgtatctacattaccctttccaatt
ttagaaattaaaaagcttagtcgatccagtggtctttcacagacggctattaatgaagac
aataagtttaaacagttaatgaaatcagttgttacaaatgagtttcaatgcagcttaata
ccaccagacttaaccacatggaaaatatgtttagaattagtacactcaaatgaattgcaa
aatgatttatttcaacttttactaagagatcaatataaattaaattccgatgattcgcta
tcacctgatgaatttttccagctgggcaaggatcgtctagaggaagagtttgacctgact
gggccgataaacaactcacaaggtagtgttgacagcggcagaagagttcgaattcacaaa
aaatcaaagcaatcggataatgaaactaaaaagaaacctattaggtattggaatgaattt
gatgaacaagaagaggataatttagacaatgctttttacattgatactaatggaagcagg
agtacaacagataacgaagaatccttacttttgagaaattctccgcctgattatgggttt
attttgtttagccggaatttcatcaaccgcacatatgatttttgtgagaagttacgaaac
ttgattcgccatgacaagaaaacatcgccagatttgtttcaaaactctaagcatccgcat
tgttcatcaactaactatggttctgttgcgtcatttggttcacaatcaacttcagcgtca
tatgatgacgttcaaaggtacttacagtatcaacagcaagacatagaggactcacaatct
atctacgaatataggcatgacgaagttgttacatttttatacttgtctgcactgctaaca
tcttgcattatggcaagtgtatgtctgggaatcgttttatccttgtttcgcgggcaaagt
aataatgagatagatttagaaattcaaaatattctcatagccattattatcatttcctta
ctggtttcccttattttgatctgtgcgtgcctgttgttgttatttagtcggttcactttg
gcgccaatctggcattatgttggttgcttcacaatgtttttctcagttactggaacagtg
tgctatggtatgattgaaattttcttttaa

DBGET integrated database retrieval system