KEGG   Saccharomyces cerevisiae (budding yeast): YDR222W
Entry
YDR222W           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Svf1 Svf1_C HNH
Other DBs
NCBI-GeneID: 851808
NCBI-ProteinID: NP_010508
SGD: S000002630
UniProt: Q04925
Position
IV:910054..911301
AA seq 415 aa
MLESSSDKIKFAPIKEVDYKKPVSKSKNYTLINDIQPLEWYCHNDSETGYQHTISNKTDG
GRGLFRVMKKSMETRVETQTLYFTDLHTGLCGFVQLLYSTVMGGIYKGFQLNFKVFGSES
NNTDYDVWESFKLDDIAEFQPLKFVSRNVIFEFLSNKNEKLGSIGQLSIKCDLPTCNNTI
QNLKIDLLVDLFQGFKMNPNGCNYYFDKQISMSDEFVSSDKMIRHVFVPRGKCNGNISYD
KKLNSGDFQNKNISLTDVPVVYLDAVQGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRD
HDNVTVTVWSITEKNKLISIGSSVQSPKRHVRFRATSTDKESGWVYPTSIKFPGGFSEHD
LRLVNRYDVLGELPSMVRSLAQKIVSIKPFIYQYCQPSKYKHEKGISIVESTFIS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcttgaatcgagcagtgataagataaagtttgcgcctattaaagaggtagattacaaa
aaaccggtaagtaagagtaagaactatactcttattaatgacatccaaccattggagtgg
tattgtcacaatgatagtgaaacgggctaccaacacaccataagtaacaagacagatggt
ggtagaggtttattcagagtgatgaaaaaatcgatggagaccagagtcgagacccaaacg
ttatatttcacagatttgcatacaggcttgtgtggatttgttcaattactgtattctacg
gttatgggtggtatctataaaggcttccaattgaatttcaaggtttttggctcagaaagt
aataatactgactacgacgtttgggaaagttttaaattggatgacatagctgaatttcaa
ccattaaagtttgtctctagaaatgttatttttgaatttttgagcaacaaaaatgaaaaa
ttaggttccattggccagttatctatcaaatgtgatttaccaacatgtaacaatacaatt
caaaatttgaaaatcgatttgttggtggatttgtttcaaggttttaagatgaaccccaac
ggttgcaattattattttgacaaacaaatctcgatgagtgacgaattcgtttcctcagac
aaaatgatcagacatgtttttgtgcccagaggtaaatgtaatggtaatatttcctacgat
aaaaaactcaatagtggggactttcaaaataaaaatatttcattaactgatgttcctgtc
gtttatctggacgctgttcaaggtcttttgccgaataaagcagccagtaaatggaatttc
ctatgttttcagagcgaaaactactctgttttagcaattgaattcactactcctcgagat
catgataacgtcaccgtaacagtttggtcaattactgaaaaaaacaaactgatatctatt
ggttcttctgtgcagagcccaaaacgtcatgttaggttccgtgctacgagtacagataag
gaaagcggctgggtatatccaacctctatcaagttccccggtggattttcagaacacgac
ttgaggctggttaatcgatacgacgttctcggtgagttaccaagcatggtcaggtcgtta
gctcagaaaattgtgagcatcaaacctttcatttatcaatactgtcaaccttctaaatat
aagcacgagaaaggtatttctatcgttgagagcaccttcattagttga

DBGET integrated database retrieval system