KEGG   Saccharomyces cerevisiae (budding yeast): YDR319C
Entry
YDR319C           CDS       T00005                                 
Symbol
YFT2, FIT2A
Name
(RefSeq) Yft2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Scs3p PAP2
Other DBs
NCBI-GeneID: 851917
NCBI-ProteinID: NP_010605
SGD: S000002727
UniProt: Q06676
Position
IV:complement(1105003..1105827)
AA seq 274 aa
MIRQLNYWSRKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKAN
QLWPFLFFSLAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQ
YACKFVLKYLLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFC
FLVSISMILWMELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHT
ILEKVLGCLMGFICPVFIYHILPKIGILHNYLYL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgatacgtcagctcaattattggtcaaggaaggcgtatctcatttacccctttcaagtt
tttgtaggcgcattattatcaatagtagtatcttcagaaacattaaaccatcaaaaagag
acatgcgctctattgaaatcgtccaatattttcaatgttatttttgcatacaaagcgaac
caactgtggccatttttattctttagtttggcttttctgcaaatatacttccactatcta
gcaagaatggatatattgcctttaccaatatcaagtaccgaaactagctcttcctattta
acatatactaaccattggcctctgctcaaaaatagaataatcagtattatgatcactcaa
tatgcttgcaagttcgttctaaaatatctattattgtttttgaatttccaatttatcgat
catgttttcatttggacagggggagaatgcagttctggtagtaaaacgacatcagctgaa
aagtgccgtctagaaaatgggaaatgggatggtgggtttgacattagtggacacttctgc
tttcttgtgagtataagcatgattctttggatggaacttcacttattcagtagatttgtt
caagctgaagatatgttttgggttgtgaataagtgggtacgagcttgccttgccattgtt
tgcgctgtcctagtaatttggatatgtattctctgggttaccgctatttattatcatact
atcttggaaaaagtgttaggttgccttatgggtttcatatgccctgttttcatataccac
attctacccaaaattgggatactacacaattacttatatctatga

DBGET integrated database retrieval system