KEGG   Saccharomyces cerevisiae (budding yeast): YDR338C
Entry
YDR338C           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
  KO
K03327  multidrug resistance protein, MATE family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR338C
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   YDR338C
SSDB
Motif
Pfam: MatE
Other DBs
NCBI-GeneID: 851938
NCBI-ProteinID: NP_010625
SGD: S000002746
UniProt: Q05497
Position
IV:complement(1147379..1149466)
AA seq 695 aa
MAGILSKTLSEVHPSLRTNGMGIGNTHRRISLGFLPPNKKNPLVRKFRARTRNIDQRSFR
SLTDDFGSNVHEPNPYLGNIDEEPDLYYHDEEDGELSRTISLPSRVSETPELSPQDVDWI
LHEHERRYSSVCNSDNEEASQSNTPDRIQEYSGRELEYDEFMNRLQAQKQKLTRSAVTDA
KGTSHHRRPSFVSVTSRGSVPTIYQEIDENDSEALAELAHSHVTFKSEARVLASYSFPLI
FTFLLEQIFPMVCSLTVGHLGKNELAAVSLASMTSNITLAIFEGIATSLDTLCPQAYGSG
RFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIPEKELINLTSRFLRVLILGAPA
YIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLVWNKYIGVGFIGAAIAVVLNFW
LMFFLLLFYALYIDGRKCWGGFSRKAFTHWNDLGHLAFSGIIMLEAEELSYELLTLFSAY
YGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIANFIGAKRTDFAHISSQVGLSFSFIA
GFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLVGIVQNFDSLNAVAGSCLRGQGMQS
LGSIVNLMAYYLFGIPLALILSWFFDMKLYGLWIGIGSAMLLIGLVEAYYVLFPDWDKIM
TYAEILKETEDDEVDSDEYLTDSDDPDENTALLGA
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggctggaattttgtcaaagactctttcagaagtgcatccttccctccgaacaaatggt
atgggtatcggtaacactcacaggaggatatcgctaggcttcctacctcccaacaagaag
aatcctctggtacgaaaatttcgtgcaagaacgagaaatattgatcagaggagtttcaga
tctttaacagatgattttggaagtaacgtccatgaaccaaatccgtacttaggtaatatt
gatgaggaacctgacctttactatcatgatgaagaagatggcgaactgagcagaacgatt
tctctaccatcaagggtatcagaaactcctgagctttcgccacaagatgttgattggatt
ctacatgaacatgaacgacgatactcatcggtatgcaactctgataatgaggaagcaagt
caaagcaacacaccagatagaatacaagaatattctggaagagaactagaatatgacgaa
tttatgaatagactccaagctcagaaacagaaattaactcgaagtgcggtaacagacgct
aaaggcacctcacatcacagaagaccatcattcgtatctgtgactagccgaggctcagtt
cccacaatttaccaagagatcgacgagaacgattctgaggcactagcagaattggctcac
agccacgtcaccttcaaatcagaagcaagagttttggcatcttattccttccctctaatt
ttcacattcttattggaacagattttccctatggtatgttcattaactgtgggccactta
ggcaaaaatgaactagcagctgtgtccttagcatccatgacttctaatataacactagcg
atattcgagggtattgccactagtctagatactctatgccctcaagcgtatggctctggg
agattctacagtgtaggagttcaccttcaacgttgcattgctttttcattggtcatatat
ataccttttgctgtcatgtggtggtattctgaacctcttctttcttatatcatccctgag
aaagaattaatcaacctaacgtcacgatttttaagagtactaatattgggagcgccagcg
tatattttttttgaaaatttaaaacgatttttacaagcccaaggtattttcgatgcaggc
atctacgttttgacaatatgtgctcccttaaacgtattagtcagttacactctcgtttgg
aacaagtacattggtgttggatttattggggctgcaattgccgttgtgcttaacttctgg
ctaatgtttttcttactattgttttatgcattgtatattgatggaagaaaatgctggggt
ggattctcaaggaaggctttcacccattggaatgatttagggcatttagccttctcaggt
attattatgttggaggcggaagagctgtcatatgaactattgacgttatttagtgcatat
tacggtgtcagttatctagcagctcagtcggcagtatctactatggctgcattgctctat
atgatcccatttgcaataggtatatctacctctacgagaattgcgaacttcattggtgca
aaaagaaccgatttcgcgcacatctcttctcaagttgggttgtcattttcgtttattgcg
gggttcatcaattgctgcatactagtatttggacgtaatctaatcgccaacatttactca
aaagatcccgaagtcatcaaattaattgcgcaagtattgcccttggtgggtattgtgcaa
aatttcgactcgcttaatgccgttgctgggtcttgcctcaggggtcaaggcatgcaatct
ctaggaagtatagtaaatttaatggcttactatctatttggaattcccctggctctcatc
ctaagttggttctttgacatgaaattgtatggtctttggattggtattggaagtgccatg
cttttaattgggctagttgaggcttattacgtattatttcccgattgggacaaaattatg
acctatgctgagattttgaaagaaaccgaagatgatgaagtagatagcgatgagtattta
acagactcagacgatcctgatgaaaacacagccctcttaggggcttaa

DBGET integrated database retrieval system