KEGG   Saccharomyces cerevisiae (budding yeast): YDR357C
Entry
YDR357C           CDS       T00005                                 
Symbol
CNL1
Name
(RefSeq) Cnl1p
  KO
K22240  biogenesis of lysosome-related organelles complex 1 subunit CNL1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR357C (CNL1)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Others
   BLOC-1 complex (yeast)
    YDR357C (CNL1)
SSDB
Motif
Pfam: BORCS6 DUF4987
Other DBs
NCBI-GeneID: 851959
NCBI-ProteinID: NP_010644
SGD: S000002765
UniProt: Q06333
Position
IV:complement(1189199..1189567)
AA seq 122 aa
MQDNSSHSRESASAGDDPLGIDKLTVDYDYLLYKMRDYVQSIQLDTTELCKKQNEVMVNG
IIENTIDKNIAKFKELLEKCDTLENHYEMLNQLAIITDTFKERIAEAVNNYNSLKKGASK
SK
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcaagacaactcaagtcattccagagagtcggcttcggctggtgacgatcctcttgga
attgataaattgacagtcgactacgattacttactttataaaatgagagactatgtacag
agtatacaattggatactacggagctatgtaaaaaacaaaatgaagtgatggtgaatggt
attattgaaaacaccatagataaaaatattgcgaagttcaaagaactccttgaaaaatgc
gatacgttggaaaatcactatgaaatgttaaaccaactggcgataataacagatactttc
aaggaaagaatcgcagaggccgtaaataattacaatagcttaaaaaagggcgccagtaaa
tctaagtaa

DBGET integrated database retrieval system