KEGG   Saccharomyces cerevisiae (budding yeast): YGR256W
Entry
YGR256W           CDS       T00005                                 
Symbol
GND2
Name
(RefSeq) phosphogluconate dehydrogenase (decarboxylating) GND2
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00030  Pentose phosphate pathway
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01200  Carbon metabolism
Module
sce_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sce_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YGR256W (GND2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YGR256W (GND2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     YGR256W (GND2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     YGR256W (GND2)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 853172
NCBI-ProteinID: NP_011772
SGD: S000003488
UniProt: P53319
Position
VII:1004624..1006102
AA seq 492 aa
MSKAVGDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLANEAKGKSIIGATSI
EDLVAKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTK
QGILFVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGS
GHYVKMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDI
LKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKR
ASKLLAGPTVPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAI
ALMWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGI
PTPAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDKDIHINWTG
HGGNISSSTYQA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtcaaaggcagtaggtgatttaggcttagttggtttagccgtgatgggtcaaaatttg
atcttaaacgcagcggatcacggatttaccgtggttgcttataataggacgcaatcaaag
gtagataggtttctagctaatgaggcaaaaggaaaatcaataattggtgcaacttcaatt
gaggacttggttgcgaaactaaagaaacctagaaagattatgcttttaatcaaagccggt
gctccggtcgacactttaataaaggaacttgtaccacatcttgataaaggcgacattatt
atcgacggtggtaactcacatttcccggacactaacagacgctacgaagagctaacaaag
caaggaattctttttgtgggctctggtgtctcaggcggtgaagatggtgcacgttttggt
ccatctttaatgcctggtgggtcagcagaagcatggccgcacatcaagaacatctttcaa
tctattgccgccaaatcaaacggtgagccatgctgcgaatgggtggggcctgccggttct
ggtcactatgtgaagatggtacacaacggtatcgagtacggtgatatgcagttgatttgc
gaggcttacgatatcatgaaacgaattggccggtttacggataaagagatcagtgaagta
tttgacaagtggaacactggagttttggattctttcttgattgaaatcacgagggacatt
ttaaaattcgatgacgtcgacggtaagccattggtggaaaaaattatggatactgccggt
caaaagggtactggtaaatggactgcaatcaacgccttggatttaggaatgccagtcact
ttaattggggaggctgttttcgctcgttgtttgtcagccataaaggacgaacgtaaaaga
gcttcgaaacttctggcaggaccaacagtaccaaaggatgcaatacatgatagagaacaa
tttgtgtatgatttggaacaagcattatacgcttcaaagattatttcatatgctcaaggt
ttcatgctgatccgcgaagctgccagatcatacggctggaaattaaacaacccagctatt
gctctaatgtggagaggtggctgtataatcagatctgtgttcttagctgagattacgaag
gcttatagggacgatccagatttggaaaatttattattcaacgagttcttcgcttctgca
gttactaaggcccaatccggttggagaagaactattgcccttgctgctacttacggtatt
ccaactccagctttctctactgctttagcgttttacgacggctatagatctgagaggcta
ccagcaaacttgttacaagcgcaacgtgattattttggcgctcatacatttagaatttta
cctgaatgtgcttctgcccatttgccagtagacaaggatattcatatcaattggactggg
cacggaggtaatatatcttcctcaacctaccaagcttaa

DBGET integrated database retrieval system