KEGG   Saccharomyces cerevisiae (budding yeast): YIL162W
Entry
YIL162W           CDS       T00005                                 
Symbol
SUC2
Name
(RefSeq) beta-fructofuranosidase SUC2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    YIL162W (SUC2)
   00500 Starch and sucrose metabolism
    YIL162W (SUC2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YIL162W (SUC2)
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 854644
NCBI-ProteinID: NP_012104
SGD: S000001424
UniProt: P00724
Structure
Position
IX:37385..38983
AA seq 532 aa
MLLQAFLFLLAGFAAKISASMTNETSDRPLVHFTPNKGWMNDPNGLWYDEKDAKWHLYFQ
YNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAPKRNDSGAFSGSMVVDYNNTSGFFNDT
IDPRQRCVAIWTYNTPESEEQYISYSLDGGYTFTEYQKNPVLAANSTQFRDPKVFWYEPS
QKWIMTAAKSQDYKIEIYSSDDLKSWKLESAFANEGFLGYQYECPGLIEVPTEQDPSKSY
WVMFISINPGAPAGGSFNQYFVGSFNGTHFEAFDNQSRVVDFGKDYYALQTFFNTDPTYG
SALGIAWASNWEYSAFVPTNPWRSSMSLVRKFSLNTEYQANPETELINLKAEPILNISNA
GPWSRFATNTTLTKANSYNVDLSNSTGTLEFELVYAVNTTQTISKSVFADLSLWFKGLED
PEEYLRMGFEVSASSFFLDRGNSKVKFVKENPYFTNRMSVNNQPFKSENDLSYYKVYGLL
DQNILELYFNDGDVVSTNTYFMTTGNALGSVNMTTGVDNLFYIDKFQVREVK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgcttttgcaagctttccttttccttttggctggttttgcagccaaaatatctgcatca
atgacaaacgaaactagcgatagacctttggtccacttcacacccaacaagggctggatg
aatgacccaaatgggttgtggtacgatgaaaaagatgccaaatggcatctgtactttcaa
tacaacccaaatgacaccgtatggggtacgccattgttttggggccatgctacttccgat
gatttgactaattgggaagatcaacccattgctatcgctcccaagcgtaacgattcaggt
gctttctctggctccatggtggttgattacaacaacacgagtgggtttttcaatgatact
attgatccaagacaaagatgcgttgcgatttggacttataacactcctgaaagtgaagag
caatacattagctattctcttgatggtggttacacttttactgaataccaaaagaaccct
gttttagctgccaactccactcaattcagagatccaaaggtgttctggtatgaaccttct
caaaaatggattatgacggctgccaaatcacaagactacaaaattgaaatttactcctct
gatgacttgaagtcctggaagctagaatctgcatttgccaatgaaggtttcttaggctac
caatacgaatgtccaggtttgattgaagtcccaactgagcaagatccttccaaatcttat
tgggtcatgtttatttctatcaacccaggtgcacctgctggcggttccttcaaccaatat
tttgttggatccttcaatggtactcattttgaagcgtttgacaatcaatctagagtggta
gattttggtaaggactactatgccttgcaaactttcttcaacactgacccaacctacggt
tcagcattaggtattgcctgggcttcaaactgggagtacagtgcctttgtcccaactaac
ccatggagatcatccatgtctttggtccgcaagttttctttgaacactgaatatcaagct
aatccagagactgaattgatcaatttgaaagccgaaccaatattgaacattagtaatgct
ggtccctggtctcgttttgctactaacacaactctaactaaggccaattcttacaatgtc
gatttgagcaactcgactggtaccctagagtttgagttggtttacgctgttaacaccaca
caaaccatatccaaatccgtctttgccgacttatcactttggttcaagggtttagaagat
cctgaagaatatttgagaatgggttttgaagtcagtgcttcttccttctttttggaccgt
ggtaactctaaggtcaagtttgtcaaggagaacccatatttcacaaacagaatgtctgtc
aacaaccaaccattcaagtctgagaacgacctaagttactataaagtgtacggcctactg
gatcaaaacatcttggaattgtacttcaacgatggagatgtggtttctacaaatacctac
ttcatgaccaccggtaacgctctaggatctgtgaacatgaccactggtgtcgataatttg
ttctacattgacaagttccaagtaagggaagtaaaatag

DBGET integrated database retrieval system