KEGG   Saccharomyces cerevisiae (budding yeast): YJR155W
Entry
YJR155W           CDS       T00005                                 
Symbol
AAD10
Name
(RefSeq) putative aryl-alcohol dehydrogenase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 853620
NCBI-ProteinID: NP_012689
SGD: S000003916
UniProt: P47182
Position
X:727405..728271
AA seq 288 aa
MASRKLRDQIVIATKFTTDYKGYDVGKGKSANFCGNHKRSLHVSVRDSLRKLQTDWIDIL
YVHWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQG
KWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAVEERKKKGEGLRTFFGTSEQ
TDMEVKISEALLKVAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKIEHLKQNIEALSIK
LTPEQIKYLESIVPFDVGFPTNFIGDDPAVTKKPSFLTEMSAKISFED
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcatcaagaaaactgcgtgaccagattgtaattgccactaaatttaccacggattat
aaggggtatgatgtaggcaaggggaagagtgccaatttctgtgggaatcacaagcgcagt
ttgcatgtaagtgtgagagattcccttcgtaagttgcaaactgattggattgatattctt
tacgttcactggtgggattatatgagctccattgaggaagttatggatagtttgcacatt
cttgtgcagcagggcaaagtactctatctaggtgtgtctgatactcctgcctgggttgtt
tctgcagcaaattactacgccacatctcatggtaaaactccctttagtatctatcaaggt
aaatggaatgtattgaacagggactttgaacgtgatatcattccaatggctaggcatttt
ggtatggctcttgctccatgggatgttatgggaggcgggagatttcagagtaaaaaggca
gtggaagagcggaagaagaaaggagaaggcttgcgtaccttttttggtacttcggaacag
acggatatggaggttaaaatcagcgaagcattgttaaaagttgcggaagaacatggcact
gagtctgtcactgctattgccatagcttatgttcggtctaaagcgaaacatgttttccca
ttagtgggaggaagaaagatcgaacatctcaaacagaacattgaggctttgagcattaaa
ttaacaccagaacaaataaagtacttagaaagtattgttccttttgatgtcggatttccc
actaattttattggagatgacccagctgttaccaagaaaccttcatttctcaccgaaatg
tctgccaagattagcttcgaagattag

DBGET integrated database retrieval system