KEGG   Saccharomyces cerevisiae (budding yeast): YKR009C
Entry
YKR009C           CDS       T00005                                 
Symbol
FOX2, POX2
Name
(RefSeq) bifunctional hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase FOX2
  KO
K14729  multifunctional beta-oxidation protein [EC:4.2.1.- 1.1.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00410  beta-Alanine metabolism
sce00640  Propanoate metabolism
sce01100  Metabolic pathways
sce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YKR009C (FOX2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YKR009C (FOX2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     YKR009C (FOX2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     YKR009C (FOX2)
SSDB
Motif
Pfam: adh_short adh_short_C2 MaoC_dehydratas KR
Other DBs
NCBI-GeneID: 853878
NCBI-ProteinID: NP_012934
SGD: S000001717
UniProt: Q02207
Position
XI:complement(454352..457054)
AA seq 900 aa
MPGNLSFKDRVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVD
EIKKAGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDVSFAKMTEREFASV
VDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLA
KEGAKYNINVNSIAPLARSRMTENVLPPHILKQLGPEKIVPLVLYLTHESTKVSNSIFEL
AAGFFGQLRWERSSGQIFNPDPKTYTPEAILNKWKEITDYRDKPFNKTQHPYQLSDYNDL
ITKAKKLPPNEQGSVKIKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDIKDPFSV
VEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDILVNNAGILRDKSFLKMKDEE
WFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFS
KTIALEGAKRGIIVNVIAPHAETAMTKTIFSEKELSNHFDASQVSPLVVLLASEELQKYS
GRRVIGQLFEVGGGWCGQTRWQRSSGYVSIKETIEPEEIKENWNHITDFSRNTINPSSTE
ESSMATLQAVQKAHSSKELDDGLFKYTTKDCILYNLGLGCTSKELKYTYENDPDFQVLPT
FAVIPFMQATATLAMDNLVDNFNYAMLLHGEQYFKLCTPTMPSNGTLKTLAKPLQVLDKN
GKAALVVGGFETYDIKTKKLIAYNEGSFFIRGAHVPPEKEVRDGKRAKFAVQNFEVPHGK
VPDFEAEISTNKDQAALYRLSGDFNPLHIDPTLAKAVKFPTPILHGLCTLGISAKALFEH
YGPYEELKVRFTNVVFPGDTLKVKAWKQGSVVVFQTIDTTRNVIVLDNAAVKLSQAKSKL
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgcctggaaatttatccttcaaagatagagttgttgtaatcacgggcgctggagggggc
ttaggtaaggtgtatgcactagcttacgcaagcagaggtgcaaaagtggtcgtcaatgat
ctaggtggcactttgggtggttcaggacataactccaaagctgcagacttagtggtggat
gagataaaaaaagccggaggtatagctgtggcaaattacgactctgttaatgaaaatgga
gagaaaataattgaaacggctataaaagaattcggcagggttgatgtactaattaacaac
gctggaatattaagggatgtttcatttgcaaagatgacagaacgtgagtttgcatctgtg
gtagatgttcatttgacaggtggctataagctatcgcgtgctgcttggccttatatgcgc
tctcagaaatttggtagaatcattaacaccgcttcccctgccggtctatttggaaatttt
ggtcaagctaattattcagcagctaaaatgggcttagttggtttggcggaaaccctcgcg
aaggagggtgccaaatacaacattaatgttaattcaattgcgccattggctagatcacgt
atgacagaaaacgtgttaccaccacatatcttgaaacagttaggaccggaaaaaattgtt
cccttagtactctatttgacacacgaaagtacgaaagtgtcaaactccatttttgaactc
gctgctggattctttggacagctcagatgggagaggtcttctggacaaattttcaatcca
gaccccaagacatatactcctgaagcaattttaaataagtggaaggaaatcacagactat
agggacaagccatttaacaaaactcagcatccatatcaactctcggattataatgattta
atcaccaaagcaaaaaaattacctcccaatgaacaaggctcagtgaaaatcaagtcgctt
tgcaacaaagtcgtagtagttacgggtgcaggaggtggtcttgggaagtctcatgcaatc
tggtttgcacggtacggtgcgaaggtagttgtaaatgacatcaaggatcctttttcagtt
gttgaagaaataaataaactatatggtgaaggcacagccattccagattcccatgatgtg
gtcaccgaagctcctctcattatccaaactgcaataagtaagtttcagagagtagacatc
ttggtcaataacgctggtattttgcgtgacaaatcttttttaaaaatgaaagatgaggaa
tggtttgctgtcctgaaagtccaccttttttccacattttcattgtcaaaagcagtatgg
ccaatatttaccaaacaaaagtctggatttattatcaatactacttctacctcaggaatt
tatggtaattttggacaggccaattatgccgctgcaaaagccgccattttaggattcagt
aaaactattgcactggaaggtgccaagagaggaattattgttaatgttatcgctcctcat
gcagaaacggctatgacaaagactatattctcggagaaggaattatcaaaccactttgat
gcatctcaagtctccccacttgttgttttgttggcatctgaagaactacaaaagtattct
ggaagaagggttattggccaattattcgaagttggcggtggttggtgtgggcaaaccaga
tggcaaagaagttccggttatgtttctattaaagagactattgaaccggaagaaattaaa
gaaaattggaaccacatcactgatttcagtcgcaacactatcaacccgagctccacagag
gagtcttctatggcaaccttgcaagccgtgcaaaaagcgcactcttcaaaggagttggat
gatggattattcaagtacactaccaaggattgtatcttgtacaatttaggacttggatgc
acaagcaaagagcttaagtacacctacgagaatgatccagacttccaagttttgcccacg
ttcgccgtcattccatttatgcaagctactgccacactagctatggacaatttagtcgat
aacttcaattatgcaatgttactgcatggagaacaatattttaagctctgcacgccgaca
atgccaagtaatggaactctaaagacacttgctaaacctttacaagtacttgacaagaat
ggtaaagccgctttagttgttggtggcttcgaaacttatgacattaaaactaagaaactc
atagcttataacgaaggatcgttcttcatcaggggcgcacatgtacctccagaaaaggaa
gtgagggatgggaaaagagccaagtttgctgtccaaaattttgaagtgccacatggaaag
gtaccagattttgaggcggagatttctacgaataaagatcaagccgcattgtacaggtta
tctggcgatttcaatcctttacatatcgatcccacgctagccaaagcagttaaatttcct
acgccaattctgcatgggctttgtacattaggtattagtgcgaaagcattgtttgaacat
tatggtccatatgaggagttgaaagtgagatttaccaatgttgttttcccaggtgatact
ctaaaggttaaagcttggaagcaaggctcggttgtcgtttttcaaacaattgatacgacc
agaaacgtcattgtattggataacgccgctgtaaaactatcgcaggcaaaatctaaacta
taa

DBGET integrated database retrieval system