KEGG   Saccharomyces cerevisiae (budding yeast): YOL157C
Entry
YOL157C           CDS       T00005                                 
Symbol
IMA2
Name
(RefSeq) oligo-1,6-glucosidase IMA2
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    YOL157C (IMA2)
   00500 Starch and sucrose metabolism
    YOL157C (IMA2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     YOL157C (IMA2)
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Other DBs
NCBI-GeneID: 854008
NCBI-ProteinID: NP_014485
SGD: S000005517
UniProt: Q08295
Position
XV:complement(22525..24294)
AA seq 589 aa
MTISSAHPETEPKWWKEATIYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWRSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVAGLPDAPVIDENSKWQP
SDPFTMNGPRIHEFHQEMNKFIRNRVKDGREIMTVGEMQHATDETKRLYTSASRHELSEL
FNFSHTDVGTSPKFRQNLIPYELKDWKVALAELFRYVNGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLVSLSGTLYVYQGQELGEINFKNWPIEKYEDVEVRNNYDAIK
EEHGENSKEMKRFLEAIALISRDHARTPMQWSREEPNAGFSGPNAKPWFYLNESFREGIN
AEDESKDPNSVLNFWKEALRFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYDNKTLFAA
LNFSSDSIDFTIPNNSSSFKLEFGNYPRSEVDASSRTLKPWEGRIYISE
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgactatttcttctgcacatccagaaacagaacccaagtggtggaaagaggccacaatc
tatcaaatttatcccgcaagtttcaaagactccaacaacgatgggtggggtgatatgaag
ggtattgcctccaagttggagtatatcaaagagcttggtgccgatgccatttggatctca
ccattctacgactcgccacaagatgatatgggttacgatattgccaactacgaaaaggtc
tggccaacctacggtacgaacgaggactgctttgccttgatcgaaaagacacataagctt
ggtatgaaatttatcaccgacttagtcatcaaccattgctcgagcgaacatgaatggttc
aaagagagcagatcctcaaaaaccaatccaaaacgtgactggttcttctggagacctcct
aagggttatgacgccgaaggcaagccaattcctccaaacaattggaggtcttacttcggt
ggttctgcatggacgttcgatgaaaagacacaagagttttacttgcgtttgttttgctcc
acccaacctgatttgaattgggagaatgaggactgtagaaaggcaatctacgaaagtgcc
gttggatactggttagaccatggtgtagacggctttagaattgatgtgggaagcttgtac
tccaaggttgctggtctaccagacgctcctgtgattgacgaaaactcaaagtggcaaccc
agtgatcctttcacaatgaacggaccacgtatccatgagtttcatcaagaaatgaacaag
ttcatcagaaacagagtgaaggatggcagagaaattatgacagttggtgaaatgcaacat
gctactgatgaaaccaagaggttgtatacaagtgcatcaagacacgaacttagtgagtta
ttcaacttttcccacactgatgtcgggacttcgcccaagttccgtcaaaatttgatccca
tatgaactaaaggattggaaggttgcccttgctgaacttttcagatacgttaacggaact
gattgttggtcaacaatttatctggaaaatcacgaccaacctcgttcaattaccagattt
ggtgacgattctcctaagaaccgtgttatttctggtaagttgttgtctgtgttgttggtg
tcactgagcggtactctatatgtgtaccaaggacaggaactgggtgaaatcaatttcaag
aactggcctatcgaaaaatacgaggatgtcgaagttagaaataactatgatgcgatcaag
gaagagcatggagaaaactcgaaggagatgaagaggtttttggaagcaattgcccttatt
tccagagaccatgctagaacacctatgcaatggtctcgtgaggagccaaatgctggtttt
tctggtcctaatgctaaaccatggttttacttgaacgagtctttcagggaaggaattaac
gctgaagacgaatccaaggatcccaactcggttttgaacttctggaaggaggccttgaga
tttagaaaggcacacaaggatattactgtatatggatatgattttgagtttattgatttg
gacaataagaaactgttcagcttcacaaagaaatacgacaacaaaacattgtttgctgct
ttgaacttcagctctgattcgattgacttcacgattccaaacaatagctcgtcgtttaag
ttggaattcggaaactacccaagaagcgaagttgatgcgtcttccagaacattgaagcca
tgggagggcagaatttacatatctgaatga

DBGET integrated database retrieval system