KEGG   Saccharomyces cerevisiae (budding yeast): YOR120W
Entry
YOR120W           CDS       T00005                                 
Symbol
GCY1
Name
(RefSeq) glycerol 2-dehydrogenase (NADP(+)) GCY1
  KO
K18097  glycerol 2-dehydrogenase (NADP+) [EC:1.1.1.156]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00561  Glycerolipid metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    YOR120W (GCY1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.156  glycerol 2-dehydrogenase (NADP+)
     YOR120W (GCY1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 854287
NCBI-ProteinID: NP_014763
SGD: S000005646
UniProt: P14065
Position
XV:551114..552052
AA seq 312 aa
MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED
QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA
YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL
ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK
KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV
VHPNWSPFEVFK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcctgctactttacatgattctacgaaaatcctttctctaaatactggagcccaaatc
cctcaaataggtttaggtacgtggcagtcgaaagagaacgatgcttataaggctgtttta
accgctttgaaagatggctaccgacacattgatactgctgctatttaccgtaatgaagac
caagtcggtcaagccatcaaggattcaggtgttcctcgggaagaaatctttgttactaca
aagttatggtgtacacaacaccacgaacctgaagtagcgctggatcaatcactaaagagg
ttaggattggactacgtagacttatatttgatgcattggcctgccagattagatccagcc
tacatcaaaaatgaagacatcttgagtgtgccaacaaagaaggatggttctcgtgcagtg
gatatcaccaattggaatttcatcaaaacctgggaattaatgcaggaactaccaaagact
ggtaaaactaaggccgttggagtctccaacttttctataaataacctgaaagatctatta
gcatctcaaggtaataagcttacgccagctgctaaccaagtcgaaatacatccattacta
cctcaagacgaattgattaatttttgtaaaagtaaaggcattgtggttgaagcttattct
ccgttaggtagtaccgatgctccactattgaaggaaccggttatccttgaaattgcgaag
aaaaataacgttcaacccggacacgttgttattagctggcacgtccaaagaggttatgtt
gtcttgccaaaatctgtgaatcccgatcgaatcaaaacgaacaggaaaatatttactttg
tctactgaggactttgaagctatcaataacatatcgaaggaaaagggcgaaaaaagggtt
gtacatccaaattggtctcctttcgaagtattcaagtaa

DBGET integrated database retrieval system