KEGG   Saccharomyces cerevisiae (budding yeast): Q0045Help
Entry
Q0045             CDS       T00005                                 

Gene name
COX1, OXI3
Definition
(RefSeq) cytochrome c oxidase subunit 1
  KO
K02256  cytochrome c oxidase subunit 1 [EC:1.9.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q0045 (COX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    Q0045 (COX1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Q0045 (COX1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    Q0045 (COX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX1
Motif
Other DBs
NCBI-GeneID: 854598
NCBI-ProteinID: NP_009305
SGD: S000007260
UniProt: P00401
Structure
PDB: 

Position
MT:join(13818..13986,16435..16470,18954..18991,20508..20984,21995..22246,23612..23746,25318..25342,26229..26701)
Genome map
AA seq 534 aa AA seqDB search
MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVV
GHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVE
SGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMH
KLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFG
HPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDAD
TRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALAN
ASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIG
ANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGL
NNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaagatgattatattcaacaaatgcaaaagatattgcagtattatattttatg
ttagctatttttagtggtatggcaggaacagcaatgtctttaatcattagattagaatta
gctgcacctggttcacaatatttacatggtaattcacaattatttaatgttttagtagtt
ggtcatgctgtattaatgattttcttcttagtaatgcctgctttaattggaggttttggt
aactatttattaccattaataattggagctacagatacagcatttccaagaattaataac
attgctttttgagtattacctatggggttagtatgtttagttacatcaactttagtagaa
tcaggtgctggtacagggtgaactgtctatccaccattatcatctattcaggcacattca
ggacctagtgtagatttagcaatttttgcattacatttaacatcaatttcatcattatta
ggtgctattaatttcattgtaacaacattaaatatgagaacaaatggtatgacaatgcat
aaattaccattatttgtatgatcaattttcattacagcgttcttattattattatcatta
cctgtattatctgctggtattacaatgttattattagatagaaacttcaatacttcattc
tttgaagtatcaggaggtggtgacccaatcttatacgagcatttattttgattctttggt
caccctgaagtatatattttaattattcctggatttggtattatttcacatgtagtatca
acatattctaaaaaacctgtatttggtgaaatttcaatggtatatgctatggcttcaatt
ggattattaggattcttagtatgatcacatcatatgtatattgtaggattagatgcagat
cttagagcatatttcctatctgcactaatgattattgcaattccaacaggaattaaaatt
ttctcatgattagctctaatccatggtggttcaattagattagcactacctatgttatat
gcaattgcattcttattcttattcacaatgggtggtttaactggtgttgccttagctaac
gcctcattagatgtagcattccacgatacttactacgtggtgggacattttcactatgta
ttatcaatgggtgctattttctctttatttgcaggatactattattgaagtcctcaaatt
ttaggtttaaactataatgaaaaattagctcaaattcaattctgattaattttcattggg
gctaatgttattttcttcccaatgcattttttaggtattaatggtatgcctagaagaatt
cctgattatcctgatgctttcgcaggatgaaattatgtcgcttctattggttcattcatt
gcactattatcattattcttatttatctatattttatatgatcaattagttaatggatta
aacaataaagttaataataaatcagttatttataataaagcacctgattttgtagaatct
aatcttatctttaatttaaatacagttaaatcttcatctatcgaattcttattaacttct
ccaccagctgtacactcatttaatacaccagctgtacaatcttaa

DBGET integrated database retrieval system