KEGG   Saccharomyces cerevisiae (budding yeast): Q0105
Entry
Q0105             CDS       T00005                                 
Symbol
COB, COB1, CYTB
Name
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Module
sce_M00151  Cytochrome bc1 complex respiratory unit
sce_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q0105 (COB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    Q0105 (COB)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    Q0105 (COB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C Ni_hydr_CYTB
Other DBs
NCBI-GeneID: 854583
NCBI-ProteinID: NP_009315
SGD: S000007270
UniProt: P00163
Structure
Position
MT:join(36540..36954,37723..37736,39141..39217,40841..41090,42508..42558,43297..43647)
AA seq 385 aa
MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIEL
AFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVII
FILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFF
ALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLIL
ALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAIL
VLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYF
AYFLIIVPVISTIENVLFYIGRVNK
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcatttagaaaatcaaatgtgtatttaagtttagtgaatagttatattattgattca
ccacaaccatcatcaattaattattgatgaaatatgggttcattattaggtttatgttta
gttattcaaattgtaacaggtatttttatggctatgcattattcatctaatattgaatta
gctttttcatctgttgaacatattataagagatgtgcataatggttatattttaagatat
ttacatgcaaatggtgcatcattcttttttatggtaatgtttatgcatatggctaaaggt
ttatattatggttcatatagatcaccaagagtactattatgaaatgtaggtgttattatt
ttcattttaactattgctacagcttttttaggttattgttgtgtttatggacagatgtca
cattgaggtgcactagttattactaatttattctcagcaattccatttgtaggtaacgat
attgtatcttgattatgaggtgggttctcagtatctaaccctctaatccagagattcttt
gcgttacattatttagtaccttttatcattgctgcaatggttattatgcatttaatggca
ttacatattcatggttcatctaatccattaggtattacaggtaatttagatagaattcca
atgcattcatactttatttttaaagatttagtaactgttttcttatttatgttaatttta
gcattatttgtattctattcacctaatactttaggtcatcctgataactatattcctggt
aatcctttagtaacaccagcatctattgtacctgaatgatacttattaccattctatgct
attttaagatctattcctgataaattattaggagttattctaatgtttgcagctatttta
gtattattagttttaccatttactgatagaagtgtagtaagaggtaatacttttaaagta
ttatctaaattcttcttctttatctttgtattcaatttcgtattattaggacaaattgga
gcatgccatgtagaagtaccttatgtcttaatgggacaaatcgctacatttatctacttc
gcttatttcttaattattgtacctgttatctctactattgaaaatgttttattctatatc
ggtagagttaataaataa

DBGET integrated database retrieval system