KEGG   Saccharomyces cerevisiae (budding yeast): Q0130
Entry
Q0130             CDS       T00005                                 
Symbol
OLI1, ATP9, OLI3
Name
(RefSeq) F0 ATP synthase subunit C
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Module
sce_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q0130 (OLI1)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 854584
NCBI-ProteinID: NP_009319
SGD: S000007274
UniProt: P61829
Structure
Position
MT:46723..46953
AA seq 76 aa
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA
TGLFCLMVSFLLLFGV
NT seq 231 nt   +upstreamnt  +downstreamnt
atgcaattagtattagcagctaaatatattggagcaggtatctcaacaattggtttatta
ggagcaggtattggtattgctatcgtattcgcagctttaattaatggtgtatcaagaaac
ccatcaattaaagacctagtattccctatggctattttaggtttcgccttatcagaagct
acaggtttattctgtttaatggtttcattcttattattattcggtgtataa

DBGET integrated database retrieval system