KEGG   Saccharomyces cerevisiae (budding yeast): YAL001C
Entry
YAL001C           CDS       T00005                                 

Gene name
TFC3, FUN24, TSV115
Definition
(RefSeq) transcription factor TFIIIC subunit TFC3
  KO
K15204  transcription factor C subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YAL001C (TFC3)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC, fungi type
     YAL001C (TFC3)
SSDB
Motif
Pfam: B-block_TFIIIC DM13
Other DBs
NCBI-GeneID: 851262
NCBI-ProteinID: NP_009400
SGD: S000000001
UniProt: P34111
Structure
PDB: 
5AIM

Position
I:complement(join(147594..151006,151097..151166))
AA seq 1160 aa
MVLTIYPDELVQIVSDKIASNKGKITLNQLWDISGKYFDLSDKKVKQFVLSCVILKKDIE
VYCDGAITTKNVTDIIGDANHSYSVGITEDSLWTLLTGYTKKESTIGNSAFELLLEVAKS
GEKGINTMDLAQVTGQDPRSVTGRIKKINHLLTSSQLIYKGHVVKQLKLKKFSHDGVDSN
PYINIRDHLATIVEVVKRSKNGIRQIIDLKRELKFDKEKRLSKAFIAAIAWLDEKEYLKK
VLVVSPKNPAIKIRCVKYVKDIPDSKGSPSFEYDSNSADEDSVSDSKAAFEDEDLVEGLD
NFNATDLLQNQGLVMEEKEDAVKNEVLLNRFYPLQNQTYDIADKSGLKGISTMDVVNRIT
GKEFQRAFTKSSEYYLESVDKQKENTGGYRLFRIYDFEGKKKFFRLFTAQNFQKLTNAED
EISVPKGFDELGKSRTDLKTLNEDNFVALNNTVRFTTDSDGQDIFFWHGELKIPPNSKKT
PNKNKRKRQVKNSTNASVAGNISNPKRIKLEQHVSTAQEPKSAEDSPSSNGGTVVKGKVV
NFGGFSARSLRSLQRQRAILKVMNTIGGVAYLREQFYESVSKYMGSTTTLDKKTVRGDVD
LMVESEKLGARTEPVSGRKIIFLPTVGEDAIQRYILKEKDSKKATFTDVIHDTEIYFFDQ
TEKNRFHRGKKSVERIRKFQNRQKNAKIKASDDAISKKSTSVNVSDGKIKRRDKKVSAGR
TTVVVENTKEDKTVYHAGTKDGVQALIRAVVVTKSIKNEIMWDKITKLFPNNSLDNLKKK
WTARRVRMGHSGWRAYVDKWKKMLVLAIKSEKISLRDVEELDLIKLLDIWTSFDEKEIKR
PLFLYKNYEENRKKFTLVRDDTLTHSGNDLAMSSMIQREISSLKKTYTRKISASTKDLSK
SQSDDYIRTVIRSILIESPSTTRNEIEALKNVGNESIDNVIMDMAKEKQIYLHGSKLECT
DTLPDILENRGNYKDFGVAFQYRCKVNELLEAGNAIVINQEPSDISSWVLIDLISGELLN
MDVIPMVRNVRPLTYTSRRFEIRTLTPPLIIYANSQTKLNTARKSAVKVPLGKPFSRLWV
NGSGSIRPNIWKQVVTMVVNEIIFHPGITLSRLQSRCREVLSLHEISEICKWLLERQVLI
TTDFDGYWVNHNWYSIYEST
NT seq 3483 nt   +upstreamnt  +downstreamnt
atggtactgacgatttatcctgacgaactcgtacaaatagtgtctgataaaattgcttca
aataagggaaaaatcactttgaatcagctgtgggatatatctggtaaatattttgatttg
tctgataaaaaagttaaacagttcgtgctttcatgcgtgatattgaaaaaggacattgag
gtgtattgtgatggtgctataacaactaaaaatgtgactgatattataggcgacgctaat
cattcatactcggttgggattactgaggacagcctatggacattattaacgggatacaca
aaaaaggagtcaactattggaaattctgcatttgaactacttctcgaagttgccaaatca
ggagaaaaagggatcaatactatggatttggcgcaggtaactgggcaagatcctagaagt
gtgactggacgtatcaagaaaataaaccacctgttaacaagttcacaactgatttataag
ggacacgtcgtgaagcaattgaagctaaaaaaattcagccatgacggggtggatagtaat
ccctatattaatattagggatcatttagcaacaatagttgaggtggtaaaacgatcaaaa
aatggtattcgccagataattgatttaaagcgtgaattgaaatttgacaaagagaaaaga
ctttctaaagcttttattgcagctattgcatggttagatgaaaaggagtacttaaagaaa
gtgcttgtagtatcacccaagaatcctgccattaaaatcagatgtgtaaaatacgtgaaa
gatattccagactctaaaggctcgccttcatttgagtatgatagcaatagcgcggatgaa
gattctgtatcagatagcaaggcagctttcgaagatgaagacttagtcgaaggtttagat
aatttcaatgcgactgatttattacaaaatcaaggccttgttatggaagagaaagaggat
gctgtaaagaatgaagttcttcttaatcgattttatccacttcaaaatcagacttatgac
attgcagataagtctggccttaaaggaatttcaactatggatgttgtaaatcgaattacc
ggaaaagaatttcagcgagcttttaccaaatcaagcgaatattatttagaaagtgtggat
aagcaaaaagaaaatacaggggggtataggctttttcgcatatacgattttgagggaaag
aagaagttttttaggctgttcacagctcagaactttcaaaagttaacaaatgcggaagac
gaaatatccgttccaaaagggtttgatgagctaggcaaatctcgtaccgatttgaaaact
ctcaacgaggataatttcgtcgcactcaacaacactgttagatttacaacggacagcgat
ggacaggatatattcttctggcacggtgaattaaaaattcccccaaactcaaaaaaaact
ccgaataaaaacaaacggaagaggcaggttaaaaacagtactaatgcttctgttgcagga
aacatttcgaatcccaaaaggattaagctagagcagcatgtcagcactgcacaggagccg
aaatctgctgaagatagtccaagttcaaacggaggcactgttgtcaaaggcaaggtggtt
aacttcggcggcttttctgcccgctctttgcgttcactacagagacagagagccattttg
aaagttatgaatacgattggtggggtagcatacctgagagaacaattttacgaaagcgtt
tctaaatatatgggctccacaacgacattagataaaaagactgtccgtggtgatgttgat
ttgatggtagaaagcgaaaaattaggagccagaacagagcctgtatcaggaagaaaaatt
atttttttgcccactgttggagaggacgctatccaaaggtacatcctgaaagaaaaagat
agtaaaaaagcaacctttactgatgttatacatgatacggaaatatacttctttgaccaa
acggaaaaaaataggtttcacagaggaaagaaatcagttgaaagaattcgtaagtttcag
aaccgccaaaagaatgctaagatcaaagcttcagatgacgctatctctaagaagagtacg
tcggtcaacgtatcagatggaaagatcaaaaggagagacaaaaaagtgtctgctggtagg
acaacggtggtcgtggaaaatactaaagaagacaaaactgtctatcatgcaggcactaaa
gatggtgttcaggctttaatcagagctgttgtagttactaaaagtattaaaaatgaaata
atgtgggacaaaataacaaaattatttcctaataattctttagataacctaaaaaagaaa
tggacggcacggcgagtaagaatgggtcatagtggttggagggcatatgtcgataagtgg
aaaaaaatgctcgttctagccattaaaagtgaaaagatttcactgagggatgttgaagaa
ctagatcttatcaaattgcttgatatttggacctcttttgatgaaaaggaaataaaaagg
ccgctctttctttataagaactacgaagagaatagaaaaaaatttactctggtacgtgat
gacacacttacacattctggcaacgatctggccatgtcttctatgattcaaagagagatc
tcttctttaaaaaaaacttacactagaaagatttccgcttctactaaggacttatcgaag
agtcaaagcgacgattatattcgcacagtgatccggtccatattaatagaaagtccttcg
accactagaaatgaaatagaggcgttgaagaacgttggaaacgaatcaatagataacgtc
atcatggatatggctaaggaaaagcaaatttatctccatggctcaaaacttgaatgtact
gatactttaccagacattttggaaaatagaggaaattataaagattttggtgtagctttt
cagtatagatgtaaggttaatgaattattggaggccggaaacgctattgttatcaatcaa
gagccgtccgatatatcctcttgggttttaattgatttgatttcgggagagctattgaat
atggatgtaattccaatggtgagaaatgttcgacctttaacgtatacttcaaggagattt
gaaatacgaacattaactccccctctgattatatatgccaattctcagacaaaattgaat
acagcaaggaagtctgctgtcaaagttccactgggcaaaccattttctcgtttatgggtg
aatggatctggttccattaggccaaacatatggaagcaggtagttactatggtcgttaac
gaaataatatttcatccagggataacattgagtagattgcaatctaggtgtcgtgaagta
ctttcgcttcatgaaatatcagaaatatgcaaatggctcctagaaagacaagtattaata
actactgattttgatggctattgggtcaatcataattggtattctatatatgaatctaca
taa

DBGET integrated database retrieval system