KEGG   Saccharomyces cerevisiae (budding yeast): YAL034W-AHelp
Entry
YAL034W-A         CDS       T00005                                 

Gene name
MTW1, DSN3, NSL2
Definition
(RefSeq) MIND complex subunit MTW1
  KO
K11559  kinetochore protein Mis12/MTW1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YAL034W-A (MTW1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    NMS complex
     MIND kinetochore complex
      YAL034W-A (MTW1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mis12
Motif
Other DBs
NCBI-GeneID: 851197
NCBI-ProteinID: NP_009367
SGD: S000000032
UniProt: P39731
Position
I:79718..80587
Genome map
AA seq 289 aa AA seqDB search
MSAPTMRSTSILTEHLGYPPISLVDDIINAVNEIMYKCTAAMEKYLLSKSKIGEEDYGEE
IKSGVAKLESLLENSVDKNFDKLELYVLRNVLRIPEEYLDANVFRLENQKDLVIVDENEL
KKSEEKLREKVNDVELAFKKNEMLLKRVTKVKRLLFTIRGFKQKLNELLKCKDDVQLQKI
LESLKPIDDTMTLLTDSLRKLYVDSESTSSTEEVEALLQRLKTNGKQNNKDFRTRYIDIR
TNNVLRKLGLLGDKEDEKQSAKPDARTQAGDIVSIDIEEPQLDLLDDVL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcccactatgagatccacctcaatattgacagagcatttgggatatccgccc
atctcgcttgttgatgatatcattaatgctgtaaatgaaattatgtacaagtgcactgct
gccatggaaaaatatctgctatccaagagcaaaatcggcgaggaagattatggagaagag
atcaaaagtggagttgctaagttggaatcacttttggaaaactccgtggataagaatttt
gacaaactagaactatatgttttgaggaacgtccttcgaatccctgaagagtatttggac
gccaatgtttttagattggagaaccaaaaggatctggtcattgtagatgagaatgagttg
aagaaaagtgaggagaaacttcgagagaaagtgaacgacgtggagttagcgttcaaaaag
aatgaaatgctattgaaaagagttacaaaagtgaaaagactgttgtttacgataagagga
ttcaaacaaaagctaaacgagttactgaaatgcaaagacgatgtacaattgcagaaaatt
ttggagtcgttaaaacctatagatgacacaatgactctactgactgattcattacgtaaa
ctatatgttgatagtgaaagtaccagttcaacagaggaggtagaggcactactgcagaga
ttgaagaccaacgggaagcaaaataataaggatttcagaacacgatatatcgatataagg
acgaataatgtcctacgaaaattggggctactaggtgataaagaggacgaaaaacagtct
gccaagccggatgcgaggacgcaagcaggggatatagttagtatagatattgaagagcct
caattggatttacttgatgatgtgttataa

DBGET integrated database retrieval system