KEGG   Saccharomyces cerevisiae (budding yeast): YAL051WHelp
Entry
YAL051W           CDS       T00005                                 

Gene name
OAF1, YAF1
Definition
(RefSeq) oleate-activated transcription factor OAF1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_clus
Motif
Other DBs
NCBI-GeneID: 851247
NCBI-ProteinID: NP_009349
SGD: S000000048
UniProt: P39720
Position
I:48564..51707
Genome map
AA seq 1047 aa AA seqDB search
MVENSTQKAPHAGNDDNSSTKPYSEAFFLGFNNPTPGLEAEHSSTSPAPENSETHNRKRN
RILFVCQACRKSKTKCDREKPECGRCVKHGLKCVYDVSKQPAPRIPSKDAIISRLEKDMF
YWKDKAMKLLTEREVNESGKRSASPINTNNASGDSPDTKKQHKMEPIYEQSGNGDINNGT
RNDIEINLYRSHPTMIMSKVMKREVKPLSENYIIIQDCFLKILVTSVFLDTSKNTMIPAL
TANANITRAQPSVANNLLKLKEMLIRQCQTEDEKNRVNEFTDRILQNTNSNRNLKIGMLL
SMLYNSVGYQYLEDHCPQGGEYSDLLRNLINECEAILPSYEIIERYKNHFYEYVYPSLPF
IELEIFEESLSQTIFPDPNNPSKVQIRMGSTHLRAKVENLSLLLVILKLSYMSIRFLDHS
TADSSFYLSKEIIDKYPIPNDFILLSQRCLASENWCACANENIISCLLYIWSFFAFSPEE
GDFFLEHPTDVISSLIMMLSTSIGLHRDPSDFPQLISPSTSDKRTLNHRRILWLSIVTVC
SFEASLKGRHSVSPISLMALFLNIKDPDSLTVYMNRVRGDLSDINNHKLLRIHKFTFKRA
QLALLLSDLDNLTMTYYGSFHLHSIEFIREKIEIFVEENFPIVPLKSVAQDKSDLDDMNV
ISEMNILSSENSSSFHNRIMNKLLMLRTSMAVFLHFETLITKDKSIFPFYKKYFMVSCMD
ALSLINYFNKFFNGEYRHAISSLTSFNVTKFIQLALSSTIFSLLGIILRIGLAIHMLSSE
VQKLSGTTDPRIKELNTKVEKFSTLQRDLESALEGIYCSASEHLRFTYFPVFKMLALFDV
IVQRMRKGELWHGIFTMIQMEQMHSRIIKTLSITLGVKLDKKDRLLEELMACNHVANFSV
EDIDELNRNIKKEIQISSGLKPPVNTIDLTNGEPFGNAVPTFTKTWSSSLDNLEKLSSAA
AVGQSLDYNSGLRQGPLAGGGSKEQTPIAGMNNLNNSINATPIVDNSSGSQLPNGFDRGQ
ANNTPFPGYFGGLDLFDYDFLFGNDFA
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaatagtacgcagaaggccccacatgccggaaatgatgataatagctctacc
aagccatattcggaggcgtttttcttagggttcaataacccaacgcctggattagaagct
gagcactcaagcacatcgcctgcccccgagaactccgaaacacataataggaaaagaaat
agaatattgtttgtctgccaggcttgtaggaagtcaaaaacaaagtgtgatagagaaaaa
cctgaatgtggtcgatgcgtcaagcatgggttaaaatgtgtttatgacgtatcaaaacag
ccagcaccacgaattccgagtaaagacgccattatatcaaggttggaaaaagatatgttt
tattggaaagataaagctatgaagctactaacagagagagaggtgaatgaatcaggcaag
agatcagcaagtccgatcaatacaaacaatgctagcggggacagtcctgataccaagaag
cagcataaaatggaacctatatatgaacaaagtggtaacggggatataaacaatggtacc
agaaatgatattgaaatcaacttgtatagaagtcatccaaccatgatcatgagtaaagtc
atgaaaagagaagttaagccgttatctgaaaattatattataattcaggactgttttcta
aaaatcctggtcacttcagtgttccttgacacttcaaagaacacgatgataccggcattg
acggcaaacgcgaatattacaagagcccagcctagcgtagcaaataaccttttgaaattg
aaggaaatgctaatcagacagtgtcaaaccgaagatgaaaaaaatcgtgtaaacgaattc
actgatagaatactacaaaatacaaattcaaatagaaacttgaaaatcggtatgctatta
tcaatgctttacaattctgtcggttaccaatatctggaggatcattgccctcaaggtggc
gaatattcggatttattgagaaatttgatcaatgaatgtgaagctattttgccatcttac
gaaattattgaacgctacaagaaccacttttatgagtacgtttatccaagtctacctttc
atcgaattagaaatttttgaagaatcattaagtcaaacaatttttccggacccaaacaac
ccctccaaggtgcaaatacgtatgggtagcacacatttgagagctaaggtggaaaacttg
agtcttctattggttatcttgaaactctcatacatgtcaataaggtttttagatcatagt
acagcagactcgagtttttatctttcaaaggaaataattgataaatacccaataccgaac
gattttattttattgagtcaaagatgtctagcatcggaaaattggtgtgcatgcgctaat
gaaaacatcatatcatgtttactatatatctggtctttttttgctttttctcctgaagag
ggtgatttctttctcgagcaccccaccgatgttatcagtagtttgataatgatgctttcc
acctcgattggtctccacagagatccttcagatttccctcaattgatttccccgtccacc
tcagataaaagaaccttgaatcacagaagaatactctggttgagtatcgttaccgtttgt
tcgtttgaagcaagtctcaaaggtagacattctgtctcaccgatatctttaatggcctta
ttcctaaatattaaggatcctgattctctgacggtatatatgaaccgagttaggggcgat
ctaagcgatatcaataatcacaaacttttgagaattcataaatttacattcaagagagcc
cagcttgcgttactcctgtcggacttagataacttgacgatgacatactatggtagtttc
catttgcattcaattgaattcataagagaaaagattgagatttttgtggaggaaaacttt
cccatagtaccattaaaaagtgtcgcacaggataagtcagaccttgatgacatgaatgtg
atttcagaaatgaatatattatcttcagaaaattcttcttcatttcacaatcgaataatg
aataaactattgatgttgagaacttcaatggccgtattcttgcattttgaaacacttatc
actaaggataaaagtatcttcccattctacaagaaatactttatggttagctgtatggat
gcgttgtcactaataaattatttcaataagtttttcaacggagaatatcgacacgcaata
tcttctttaaccagttttaatgttacaaaatttattcagttagcactatccagcacaatc
ttcagcctattagggattatactaagaataggtttagccatccatatgttatcttctgaa
gtacaaaagttatcgggaacgacagatccaagaataaaggagttaaataccaaagtcgaa
aaatttagtaccctgcaaagagatctcgagtctgctttagaaggtatatattgctctgct
tcggaacatttaagattcacatacttccccgtttttaagatgttggctttattcgatgtc
attgtacaaaggatgagaaagggtgaattatggcacggcatatttacgatgattcaaatg
gaacaaatgcattctaggataatcaagacattaagcattaccttaggagtcaaactggac
aaaaaggataggctattagaggaattgatggcatgcaatcacgttgcgaattttagcgtt
gaagatatagatgagctgaaccgtaatatcaaaaaagagattcaaatttcttcaggattg
aagccgcctgtaaacacaattgacttaaccaacggcgaaccattcggaaatgctgttcct
accttcacaaagacatggagttcatccttagataatttagaaaaactatcatcggccgct
gcagttggtcagagcttggactacaacagtggtttacgtcagggtcctttggcgggtggt
ggttcaaaagagcaaacgccaatagccgggatgaataacttgaacaattcaatcaatgct
acaccaattgtcgataactcatctggatcacaacttcctaatggtttcgatagaggccaa
gcgaataatactccttttccaggttattttggaggtttggatttatttgattatgacttt
ttgtttggcaatgactttgcttaa

DBGET integrated database retrieval system