KEGG   Saccharomyces cerevisiae (budding yeast): YAL053WHelp
Entry
YAL053W           CDS       T00005                                 

Gene name
FLC2
Definition
(RefSeq) flavin adenine dinucleotide transporter FLC2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRP TRP_N DUF2981
Motif
Other DBs
NCBI-GeneID: 851246
NCBI-ProteinID: NP_009348
SGD: S000000049
UniProt: P39719
Position
I:45899..48250
Genome map
AA seq 783 aa AA seqDB search
MIFLNTFARCLLTCFVLCSGTARSSDTNDTTPASAKHLQTTSLLTCMDNSQLTASFFDVK
FYPDNNTVIFDIDATTTLNGNVTVKAELLTYGLKVLDKTFDLCSLGQVSLCPLSAGRIDV
MSTQVIESSITKQFPGIAYTIPDLDAQVRVVAYAQNDTEFETPLACVQAILSNGKTVQTK
YAAWPIAAISGVGVLTSGFVSVIGYSATAAHIASNSISLFIYFQNLAITAMMGVSRVPPI
AAAWTQNFQWSMGIINTNFMQKIFDWYVQATNGVSNVVVANKDVLSISVQKRAISMASSS
DYNFDTILDDSNLYTTSEKDPSNYSAKILVLRGIERVAYLANIELSNFFLTGIVFFLFFL
FVVVVSLIFFKALLEVLTRARILKETSNFFQYRKNWGSIIKGTLFRLSIIAFPQVSLLAI
WEFTQVNSPAIVVDAVVILLIITGLLVYGTIRVFIKGRESLRLYKNPAYLLYSDTYFLNK
FGFLYVQFKADKFWWLLPLLSYAFLRSLFVAVLQNQGKAQAMIIFVIELAYFVCLCWIRP
YLDKRTNVFNIAIHLVNLINAFFFLFFSNLFKQPAVVSSVMAVILFVLNAVFALFLLLFT
IVTCTLALLHRNPDVRYQPMKDDRVSFIPKIQNDFDGKNKNDSELFELRKAVMDTNENEE
EKMFRDDTFGKNLNANTNTARLFDDETSSSSFKQNSSPFDASEVTEQPVQPTSAVMGTGG
SFLSPQYQRASSASRTNLAPNNTSTSSLMKPESSLYLGNSNKSYSHFNNNGSNENARNNN
PYL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcctaaacaccttcgcaaggtgccttttaacgtgtttcgtactgtgcagcggt
acagcacgttcctctgacacaaacgacactactccggcgtctgcaaagcatttgcagacc
acttctttattgacgtgtatggacaattcgcaattaacggcatcattctttgatgtgaaa
ttttaccccgataataatactgttatctttgatattgacgctacgacgacgcttaatggg
aacgtcactgtgaaggctgagctgcttacttacggactgaaagtcctggataagactttt
gatttatgttccttgggccaagtatcgctttgccccctaagtgctgggcgtattgatgtc
atgtccacacaggtgatcgaatcatccattaccaagcaatttcccggcattgcttacacc
attccagatttggacgcacaagtacgtgtggtggcatacgctcagaatgacacggaattc
gaaactccgctggcttgtgtccaggctatcttgagtaacgggaagacagtgcaaacaaag
tatgcggcctggcccattgccgctatctcaggtgtcggtgtacttacctcagggtttgtg
tctgtgatcggttactcagccactgctgctcacattgcgtccaactccatctcattgttc
atatacttccaaaatctagctatcactgcaatgatgggtgtctcaagggttccacccatt
gctgccgcgtggacgcagaatttccaatggtccatgggtatcatcaatacaaacttcatg
caaaagatttttgattggtacgtacaggccactaatggtgtctcaaatgttgtggtagct
aacaaggacgtcttgtccattagtgtgcaaaaacgtgctatctctatggcatcgtctagt
gattacaattttgacaccattttagacgattcgaatctgtacaccacttctgagaaggat
ccaagcaattactcagccaagattctcgtgttaagaggtatagaaagagttgcttatttg
gctaatattgagctatctaatttctttttgaccggtattgtgttttttctattcttccta
tttgtagttgtcgtctctttgattttctttaaggcgctattggaagttcttacaagagca
agaatattgaaagagacttccaatttcttccaatataggaagaactgggggagtattatc
aaaggcacccttttcagattatctatcatcgccttccctcaagtttctcttctggcgatt
tgggaatttactcaggtcaactctccagcgattgttgttgatgcggtagtaatattactg
atcatcacgggacttctggtttatggaactataagggttttcatcaagggaagagagtct
ctcagattatacaagaatcctgcgtacctactttacagtgatacctacttcttgaacaag
tttgggttcttatacgttcaattcaaagcagataagttttggtggcttttacccttatta
agttatgcgttcttaagatccctgtttgttgccgttttacaaaaccaaggtaaggctcaa
gcaatgatcatctttgtcattgaactagcttacttcgtttgtctctgttggataagacca
tatttggacaagagaactaatgttttcaatattgctattcatttggtgaatttgatcaat
gcatttttctttttgtttttcagtaatttgttcaagcaaccagcagtggtttcgtcagtg
atggcggttattctgttcgttttgaacgcggtgtttgctctattcctattattgttcact
attgtcacctgtacactggcattactacacagaaacccagatgtccgttaccaaccaatg
aaagatgaccgtgtgtcattcattcctaagattcaaaatgatttcgatggcaaaaacaaa
aatgattctgaactgtttgaattgagaaaagctgttatggacaccaatgaaaatgaggaa
gaaaaaatgttccgtgacgacactttcggcaagaacctgaatgcaaacacaaatacagca
agactctttgatgatgagactagttcatcctcttttaagcaaaattcctctcccttcgat
gcctcggaagtaacggagcaacctgtgcaaccaacctccgctgtcatgggtacgggtggc
agcttcttgtctccacagtaccaacgtgcgtcatctgcttctcgtactaatctagcgccg
aataatacaagcacctccagtttaatgaagcctgaatcaagtctctacctggggaattcc
aataaatcatattcgcattttaacaacaacggcagcaacgaaaacgcccgcaacaacaac
ccatatttgtaa

DBGET integrated database retrieval system