KEGG   Saccharomyces cerevisiae (budding yeast): YAL056WHelp
Entry
YAL056W           CDS       T00005                                 

Gene name
GPB2, KRH1
Definition
(RefSeq) Gpb2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kelch_5 Kelch_4 Kelch_1 Kelch_2
Motif
Other DBs
NCBI-GeneID: 851243
NCBI-ProteinID: NP_009345
SGD: S000000052
UniProt: P39717
Position
I:39259..41901
Genome map
AA seq 880 aa AA seqDB search
MEISSSPWNDGGYSPYERNRVAVSPFSSALEGEERIETSRSLGDHCFEPLPYVTNYLSIF
ALFGKEIFGDKGNVSSRNEYLLKKYYSLKKPFVLRHNGHALKNPDMPLQRNDILQTNFMV
DKFLNRTVRSVNFNNFKIISDMQSKSGRGTKSGTNQNQSADAIQNICLPSIPSALPYFQY
YRKLLTVNTKEWDILKLHSLWVPKLRKDFKDFSLYGDKNSLKPIDSHYDEDNTMKKNLFF
ERSPSRQTLDGKGCASKGYDISSGNMIIPSLFSEDKLPALTYHCSVELNGNIYIFGGLMP
CYSYEEDAPMLNDFFVDGIKNLPPPLLPQVINNPSMVNNPHLYVASIPSCRFSKPKMGGY
IPPPLLCVQGSKLTDRHIFFYGGFEIRTETRGDENGKYHLKKRLYVNNTGYILDIMSFKF
TKIDIIVQPSKYNAYPTMSSRFGHLQISIDNPNRRASVHSSSMNEIHKMGSASMKQGSSI
TSGRLEKAAVLSSLPHNTVHTVIIFGGYRQTGDDRYEAMNDLWKIEIPVIRRGKKGYCKF
SETANAILLTPSEKDKSDWPEERAFSAFSVHGTSLMDRSSLDMRLLNNLKNHFVLKPSYI
SQDRVVSPKPVFPMMVHGTHQDLFNSGSAAQESPKAGASASSASAASFDPDMDDNLENYI
VNPGRKSSSIPMTAIGRQRLILSQEKPVGKTVVLHGGSNGLNVLDDMWLMDLECETWTPI
ETFAKADSSEDGDEKLDSVNVGLVGHRMESIGRICVCIGGMVQEDVDQFYSENDDEPPRK
RKVDTLPLGGNFLNTIDLSTQCWEEHKITLSKKEDDEDRQDSENEDTNSNIVVGVGGTSL
QCDKSIILIGGLISRRSNVKEIYLHGTITKSIFPSVNPSA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttccagttcaccatggaacgacggtggatacagcccctatgagagaaacaga
gtcgctgtatcaccattttcatcagcgttggaaggcgaagaacgaatagaaacctctcga
tctttgggtgatcattgctttgaacctttgccatacgtgacgaattatctttctattttc
gcgctttttggtaaagagatatttggtgacaagggaaatgtgagctcaagaaatgaatat
ttgctaaaaaaatactactctttgaaaaagccatttgtattgcgacataatgggcatgcg
ttgaagaatcccgacatgccactccagaggaatgacatattgcaaaccaatttcatggtt
gacaaatttctgaatcgtactgtgcggtcagtgaattttaataatttcaagataatatca
gatatgcaaagtaaaagcggtcgaggaacaaagtcaggcacaaatcagaatcaaagtgcc
gacgctattcaaaatatttgtctaccatctataccgtcggcgttgccttatttccagtat
tataggaagctattgacagttaataccaaagaatgggatattttaaaactgcacagttta
tgggtaccaaagctaaggaaggattttaaagatttttcgttgtatggtgataaaaactct
ttaaagccgatcgatagtcactatgatgaggataataccatgaagaaaaatttatttttt
gaaagatctccaagtcgacagactctagatggtaaagggtgtgcctctaaggggtatgac
atttcttccggtaatatgattatcccatccctattttctgaagataagctgccggcttta
acttatcattgttccgtagaattaaatggaaacatttacatatttgggggattgatgcca
tgctacagctatgaggaggatgcgccgatgctgaacgatttttttgtagacggaataaag
aacttacctccgcctttactacctcaagtgattaataatccatcaatggtcaataatcct
catctttatgtcgcttctataccatcatgccggtttagcaaacctaaaatggggggttat
ataccgcctccattgctatgtgttcaaggatccaaattaacggaccgacatattttcttt
tatggcggatttgaaatcaggacagaaacccgtggtgatgaaaatgggaagtatcatctc
aagaaaagattatatgtgaataacactggttacatactcgatattatgtcgttcaagttc
actaaaatagatatcatagtacaaccttccaaatataatgcatatccgacaatgtcatcg
aggtttggtcacttacaaatttctattgataatccaaataggagagctagcgttcattct
tcaagcatgaacgaaattcataaaatggggagtgcttccatgaaacaaggtagcagcatc
acttccgggcggcttgaaaaagcagcagtactttcatcattacctcataatactgtgcac
acggttataatatttggtggttacagacaaaccggtgatgatcgttacgaagcaatgaat
gatttgtggaagatagagatacccgtgatacgtcgcggtaaaaaaggttattgtaagttt
tcagagacagctaacgcgatactactgacgccaagcgaaaaggacaaatcggattggccc
gaagaaagagccttttctgccttttctgttcatgggacttcgttaatggataggagttct
cttgacatgagactattgaacaacttaaaaaaccattttgttttaaaaccgtcatatata
tcacaggatcgcgttgttagtcctaaaccggttttccccatgatggttcatggcacgcat
caagatcttttcaatagtggctctgcggcacaagaatcgcccaaagctggtgcctcggcc
agcagcgcaagtgctgcgagctttgatcccgatatggacgataatttggaaaattatata
gtcaatccagggagaaaatcgtcatctattccaatgactgcgatagggagacagagatta
attttaagccaagagaagccagtaggtaaaactgttgtattgcatggtgggtctaacggt
ctcaacgttcttgatgatatgtggttgatggacttagagtgtgagacatggactccaata
gagacatttgcaaaggcagattcgagcgaagacggtgatgaaaaattggatagtgtgaac
gtaggtctcgttggccacagaatggaaagtattggacgaatatgtgtatgtataggtggt
atggtacaagaggatgttgaccaattttactcggagaatgatgatgagcctcctcgaaaa
cgcaaggtcgatacattaccgttgggtggtaattttttgaacacaattgatttaagcacg
cagtgttgggaagaacataaaattactctgtccaagaaggaagacgatgaggacagacaa
gatagcgaaaatgaagatacaaattcaaatatagtagttggtgtcggtggcacttctttg
caatgtgacaaaagtattattttgattggcggattgatatctagacggagcaatgtaaaa
gaaatatatttacatggtaccataacgaaaagtatttttcctagcgtaaatcctagtgca
taa

DBGET integrated database retrieval system