KEGG   Saccharomyces cerevisiae (budding yeast): YAL058WHelp
Entry
YAL058W           CDS       T00005                                 

Gene name
CNE1, FUN48
Definition
(RefSeq) calnexin
  KO
K08054  calnexin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YAL058W (CNE1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YAL058W (CNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YAL058W (CNE1)
   04131 Membrane trafficking [BR:sce04131]
    YAL058W (CNE1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:sce04091]
    YAL058W (CNE1)
Chaperones and folding catalysts [BR:sce03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   YAL058W (CNE1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    YAL058W (CNE1)
Lectins [BR:sce04091]
 Calnexin / calreticulin
  YAL058W (CNE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Calreticulin
Motif
Other DBs
NCBI-GeneID: 851241
NCBI-ProteinID: NP_009343
SGD: S000000054
UniProt: P27825
Position
I:37464..38972
Genome map
AA seq 502 aa AA seqDB search
MKFSAYLWWLFLNLALVKGTSLLSNVTLAEDSFWEHFQAYTNTKHLNQEWITSEAVNNEG
SKIYGAQWRLSQGRLQGSAWDKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLD
NSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITH
ESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEP
PITPPLMIPDVSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIP
EYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEI
INPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEA
QIIGNKTWLMRDRAFRGSDGPTERKFMNSRLGNLQTTFHNERESPNPFDRIIDRILEQPL
KFVLTAAVVLLTTSVLCCVVFT
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttctgcgtatttatggtggctgtttttgaatctagcgttggtgaaaggcact
tcattgctatccaacgttacattagcggaagattctttctgggagcattttcaggcttac
actaatacaaagcatttaaaccaagagtggatcacaagtgaagccgtcaacaatgaaggc
tctaaaatatatggtgcacaatggcgactatcacagggtcgattgcaaggatccgcatgg
gataaaggaatcgcagttcgaacaggcaatgccgcagctatgataggacatctcttggag
acacctattaatgtttcagaaacggataccttggttgtccagtacgaaattaagttggac
aattctttgacgtgcggcggtgcgtttattaagttaatgtctggtttcatgaatgttgaa
gcattaaaacactatgcacccgatacagagggtgtcgagttagtttttggtccggattat
tgtgctcctgaaataaatggcgtgcaatttgccatcaataaggttgacaagatcacacat
gaatctaaactaagatatttgcaagagatgcccctgtcaaaattaactgatacctcgcaa
tctcatctgtatacgctcataatagatgaatcagcgcagtcttttcaaattcttatagac
ggtaagacggttatggtaagagaacatatcgaagacaagaaaaaggtcaattttgagcca
cccattacaccgcctttaatgattcctgatgtttcagtagcgaaaccgcatgattgggat
gatcgcatccgaatcccagatcctgaggcggtgaagctcagtgatcgggatgaacgagac
ccattgatgattccacatccagatggcactgaaccaccagaatggaacagctccatcccc
gaatacattcttgacccaaatgctcaaaagccctcgtggtggaaggaacttgagcacggg
gaatggataccgcccatgattaaaaatcctctttgcactgcagaacgtggttgtggccag
cagataccagggctgataaataatgccaagtacaaaggtccaggcgaactcaatgaaatc
ataaatcccaattacatgggggaatggcatccaccggaaattgaaaacccgctatactac
gaagagcagcacccattgcgcatcgaaaacgttatcagtggtgtgatcctcgagttttgg
agtggatctccaaacatgttgataagcaacatttatgttggtaaaaatgtaacagaggcg
caaattattgggaataagacttggctgatgagagaccgcgcgtttagaggctccgatggc
cccacagaacgcaaattcatgaatagcagactaggaaatctacaaacaactttccataac
gaaagagaatcccctaatccatttgaccgcattatagatcgcatattagagcaacctctg
aaatttgtgcttactgcggccgtcgtgctcttgacgacgtcggttctttgttgtgtagta
tttacatag

DBGET integrated database retrieval system