KEGG   Saccharomyces cerevisiae (budding yeast): YAL059WHelp
Entry
YAL059W           CDS       T00005                                 

Gene name
ECM1
Definition
(RefSeq) Ecm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alb1 DUF4426
Motif
Other DBs
NCBI-GeneID: 851240
NCBI-ProteinID: NP_009342
SGD: S000000055
UniProt: P39715
Position
I:36509..37147
Genome map
AA seq 212 aa AA seqDB search
MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDL
TNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFT
NRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDE
EIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaacaaagacgacaaaaggtagttttttccttgactatactggtaagatatcgt
ctaaaacaaagcatggccaagaaaatatcaaagaattcaagagctgctagacaatcggat
gctcttgaaccagaggtaaaggatttaagtgaactacctagagctgaaaaaaccgatttg
actaatattttgattagaacagcagccaagaatgaggcattgctggaagcaaagatatct
aagaaagccaataaaagtaagaggggcaagaagttaaataaaaaggctctggaagacaaa
ctggccaactctatttcatccatggacagggatcgtttagtgaaggccttgaattttacc
aatcgtctggacggtaaaattgccaagtccatttctcgtgccaagtacattcaaaataca
agaaaggctggctgggatagcaccaatgagactataaaaaaagagctggcttttttgaac
ggagggttgtctgtgcaggcaaaaagtgctagtgaaggtaatgctgaaaaggaagatgag
gagatcccagaagtttttgactctttagcagaggataacacagtgcagaagactcctaca
aatagattcggtgtcctgccagacgatgttgaagaatag

DBGET integrated database retrieval system