KEGG   Saccharomyces cerevisiae (budding yeast): YAL060WHelp
Entry
YAL060W           CDS       T00005                                 

Gene name
BDH1
Definition
(RefSeq) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YAL060W (BDH1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     YAL060W (BDH1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     YAL060W (BDH1)
    1.1.1.-  
     YAL060W (BDH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 851239
NCBI-ProteinID: NP_009341
SGD: S000000056
UniProt: P39714
Position
I:35155..36303
Genome map
AA seq 382 aa AA seqDB search
MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECH
KLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPC
DACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH
AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNP
SKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF
QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQE
LMDHKESNVKILLTPNNHGEMK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttggcatatttcaagaagggtgatattcacttcactaatgatatccctagg
ccagaaatccaaaccgacgatgaggttattatcgacgtctcttggtgtgggatttgtggc
tcggatcttcacgagtacttggatggtccaatcttcatgcctaaagatggagagtgccat
aaattatccaacgctgctttacctctggcaatgggccatgagatgtcaggaattgtttcc
aaggttggtcctaaagtgacaaaggtgaaggttggcgaccacgtggtcgttgatgctgcc
agcagttgtgcggacctgcattgctggccacactccaaattttacaattccaaaccatgt
gatgcttgtcagaggggcagtgaaaatctatgtacccacgccggttttgtaggactaggt
gtgatcagtggtggctttgctgaacaagtcgtagtctctcaacatcacattatcccggtt
ccaaaggaaattcctctagatgtggctgctttagttgagcctctttctgtcacctggcat
gctgttaagatttctggtttcaaaaaaggcagttcagccttggttcttggtgcaggtccc
attgggttgtgtaccattttggtacttaagggaatgggggctagtaaaattgtagtgtct
gaaattgcagagagaagaatagaaatggccaagaaactgggcgttgaggtgttcaatccc
tccaagcacggtcataaatctatagagatactacgtggtttgaccaagagccatgatggg
tttgattacagttatgattgttctggtattcaagttactttcgaaacctctttgaaggca
ttaacattcaaggggacagccaccaacattgcagtttggggtccaaaacctgtcccattc
caaccaatggatgtgactctccaagagaaagttatgactggttcgatcggctatgttgtc
gaagacttcgaagaagttgttcgtgccatccacaacggagacatcgccatggaagattgt
aagcaactaatcactggtaagcaaaggattgaggacggttgggaaaagggattccaagag
ttgatggatcacaaggaatccaacgttaagattctattgacgcctaacaatcacggtgaa
atgaagtaa

DBGET integrated database retrieval system