KEGG   Saccharomyces cerevisiae (budding yeast): YAL067C
Entry
YAL067C           CDS       T00005                                 

Symbol
SEO1
Name
(RefSeq) putative permease SEO1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 851230
NCBI-ProteinID: NP_009333
SGD: S000000062
UniProt: P39709
Position
I:complement(7235..9016)
AA seq 593 aa
MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTS
EKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWF
KQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQ
VMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAF
EAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWR
WNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVF
DIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGL
GMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMA
PVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSA
FCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEK
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtattcaattgttaaagagattattgtagatccttacaaaagactaaaatggggtttt
attccagtaaagcggcaggtggaagacctgccagatgacttaaattcaacagaaattgtc
actatctccaacagtatccagagtcatgaaacagctgaaaatttcatcacgactacaagt
gaaaaagatcaactacattttgagactagtagctatagtgaacataaagacaatgtgaac
gttactagaagttatgaatatagagatgaagccgataggccatggtggagatttttcgat
gaacaagagtatcggatcaatgaaaaggaaagatctcacaataaatggtatagttggttc
aaacagggtacctctttcaaagaaaaaaaattattaattaaattggatgtccttttagcc
ttttattcttgtattgcttattgggtgaaatatctggatacggttaatataaacaacgct
tacgtttcgggaatgaaggaagatttaggctttcaaggtaatgatttggtgcatactcaa
gtaatgtacacagttggtaatattatatttcaattgccatttttgatttacctgaacaag
ctcccattaaactatgttttaccaagcctcgacttatgttggtcgcttttaaccgttggt
gctgcatatgtcaattctgtaccacacttgaaagcaattaggtttttcattggggctttt
gaagcgccaagttatttggcataccaatatttgtttggttccttttacaaacatgatgaa
atggtgcgtcgttctgctttttactatttgggccagtatatcggtattctatccgctggt
gggatccagtcagccgtatattcatcgttaaatggtgtaaatggtttagagggatggaga
tggaactttattattgacgctattgtgtctgtcgtagtgggccttattggattttactcc
ctgccaggtgacccatacaactgttattctattttcttaactgatgatgaaattaggttg
gcgaggaaaagattaaaagaaaaccaaacaggtaaaagtgattttgaaacaaaagtattc
gatattaaactgtggaaaacaattttcagtgattggaaaatatacattttaactttatgg
aatattttctgttggaatgacagtaatgtttcatctggggcatacctactatggttgaaa
tctttgaaaagatactctattcctaagctcaatcagttatccatgattactccgggttta
ggtatggtttatttgatgcttactggtattattgcagataaattacactctcgttggttt
gcgattatttttactcaggttttcaatatcattggtaactccatattagccgcttgggac
gtcgcagaaggagccaaatggtttgcatttatgctgcaatgttttggttgggctatggct
cctgttttatactcttggcaaaacgatatttgtcgccgagatgctcaaactagagctatt
actttagttacaatgaatattatggctcaatcatctaccgcatggataagtgttttggtt
tggaaaacagaagaagctcccaggtatttaaaggggtttactttcactgcatgttctgct
ttttgtctctccatttggacttttgttgtactctacttctataaacgtgatgaaaggaac
aatgccaagaagaacggtattgtgctttataactctaaacatggtgtggaaaagccaacg
tcaaaagacgttgaaaccttatcagtatctgatgaaaaataa

DBGET integrated database retrieval system