KEGG   Saccharomyces cerevisiae (budding yeast): YAR018CHelp
Entry
YAR018C           CDS       T00005                                 

Gene name
KIN3, FUN52, NPK1
Definition
(RefSeq) serine/threonine protein kinase KIN3
  KO
K20872  NIMA (never in mitosis gene a)-related kinase 2 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YAR018C (KIN3)
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YAR018C (KIN3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YAR018C (KIN3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YAR018C (KIN3)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  NEK family
   YAR018C (KIN3)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YAR018C (KIN3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     YAR018C (KIN3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal PPP5 HHA Kinase-like Mfa1
Motif
Other DBs
NCBI-GeneID: 851273
NCBI-ProteinID: NP_009410
SGD: S000000071
UniProt: P22209
Position
I:complement(170396..171703)
Genome map
AA seq 435 aa AA seqDB search
MHRRQFFQEYRSPQQQQGHPPRSEYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIKYGH
MNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQ
EHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNI
FLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLET
SIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKI
KNGKCDTVPEYYSRGLNAIIHSMIDVNLRTRPSTFELLQDIQIRTARKSLQLERFERKLL
DYENELTNIEKILEKQAIEYERELSQLKEQFTQAVEERAREVISGKKVGKVPESINGYYG
KKFAKPAYHWQTRYR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcatagacgacagtttttccaagaataccgtagtcctcagcagcagcagggacaccca
ccaaggtcagaataccaagttctcgaagaaattgggagaggttcatttgggtctgtacga
aaagtcatccatatacctaccaagaaacttttggttagaaaggatatcaaatatggccat
atgaatagcaaagagagacaacagctgatcgctgaatgtagcattctatcgcagttgaag
catgaaaatattgtagaattttataactgggacttcgatgaacaaaaagaagtgttatac
ctttatatggaatattgttccaggggtgatttatcccagatgattaagcactacaaacag
gagcataaatatataccagaaaaaattgtgtggggtatcctggcccaattattgactgcg
ctctataaatgtcattatggtgttgaattgccaactttgaccacaatatatgaccggatg
aaaccaccggtaaaaggcaaaaacatcgttatccatcgtgatctgaaaccaggaaatata
ttcttaagctatgatgatagcgattacaatattaatgaacaagtagacggtcacgaggaa
gtgaatagtaattattacagagaccatagagtgaattcagggaaaagggggagccctatg
gactatagtcaagttgtggtaaagttaggtgattttgggttagccaaatctctggaaact
agtattcaatttgccacaacatacgtcggtacaccatattacatgtcgcctgaagtgttg
atggaccaaccatactccccactatccgacatctggtcactaggttgtgttatttttgag
atgtgttcgttgcaccccccatttcaggcaaaaaattatctcgagctacaaactaagatt
aaaaacgggaaatgtgacaccgtccctgagtattactctagagggcttaatgccataata
cattcaatgatagatgtgaacttaagaaccaggccttccacttttgaattactgcaagat
attcagatacgaactgcaagaaagtcgttgcaattagagagatttgaaaggaagttactg
gactatgaaaatgagctgacaaacattgaaaaaatcctcgagaagcaagctattgaatac
gaaagagaactgagtcagttgaaggaacaatttacccaggcagtggaggagcgagccagg
gaagtaattagcggtaagaaagttggtaaggttccagaatctataaacggatattatggt
aaaaaatttgccaaacctgcataccactggcaaacaagatatcgataa

DBGET integrated database retrieval system