KEGG   Saccharomyces cerevisiae (budding yeast): YAR028WHelp
Entry
YAR028W           CDS       T00005                                 

Definition
(RefSeq) DUP240 family protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUP Mg_trans_NIPA
Motif
Other DBs
NCBI-GeneID: 851280
NCBI-ProteinID: NP_009415
SGD: S000000076
UniProt: P39548
Position
I:184892..185596
Genome map
AA seq 234 aa AA seqDB search
MQTPSENTDVKMDTLDEPSAHLIEENVALPEDTFSSHLSYVLYEIAHCKPIMFMIIIIVS
LISLIVLFHDNDGCTVILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVIARKPA
GKEWGTVAYNMNQYLFMKRLWYTPYYFYSGKKCHEFFTTLIKEVNSGSHSDSSSNSAEDT
QSPVSAGKTSNGLNNFYSIRSDPILMAYVLKATQIEKEAQSEYWRKQYPDADLP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaccttcagaaaataccgacgtaaagatggatactctcgacgaacccagtgca
catttaatcgaagagaatgtagctcttcccgaagacacattcagttcacatctgagttat
gtactttatgaaattgctcattgtaaaccgatcatgtttatgatcatcataatcgtgagt
ttgatctcattgattgtgctttttcatgataacgacgggtgcactgtgatcttagtgatg
tcccttatagtagcctccatggctttaatggtggttgcagcattcacattcgggaaagcg
atcactgaacaggagttcatgataaagcttttagtggaggtgatcgcacgcaagcctgcg
gggaaggaatggggtactgtcgcatataatatgaaccaatatctattcatgaagagacta
tggtataccccgtactatttctatagcggcaagaagtgccatgagttcttcaccactctt
atcaaggaagtgaattctggttcgcactcggattcctcatcgaatagtgccgaggataca
caatcacctgtctcagcagggaagacttcaaatggtctaaacaacttttatagtattaga
tcagaccctattttgatggcatatgttttgaaggcaacacaaatagaaaaggaggctcaa
agtgaatactggagaaagcaatatcctgacgctgatttaccttga

DBGET integrated database retrieval system