KEGG   Saccharomyces cerevisiae (budding yeast): YAR031WHelp
Entry
YAR031W           CDS       T00005                                 

Gene name
PRM9
Definition
(RefSeq) pheromone-regulated DUP240 family protein PRM9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUP OppC_N Phtf-FEM1B_bdg
Motif
Other DBs
NCBI-GeneID: 851282
NCBI-ProteinID: NP_009418
SGD: S000000078
UniProt: P39551
Position
I:186836..187732
Genome map
AA seq 298 aa AA seqDB search
MSPQYHFYFVSFRNLVLNEKCLRSKKQVMKSFNWYKTDRYFDPHNILQHHSRAIEKTRYK
LGMQTSSESTDAKSDFLDEPSAYLIEKNVALPKDIFGSYLSYWIYEVTRHKAAVILLVLI
VTSILLLVFFYNTEFCVAFEILLFSFCFPGTCMVVIAFSEPIGDREFKVKLLMEIITRKP
AVKGKEWRTITYKMNQYLFDHGLWDTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNV
KDAQSNDETAGTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVDEFF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctcaataccatttttattttgtatcattccggaacttagtattgaatgaaaaa
tgcctccgaagtaaaaagcaggtgatgaaaagtttcaattggtataagacagatcgctat
tttgatccgcataacatccttcaacaccatagcagagctatagagaagacaagatataaa
ctgggcatgcaaacatcttcagaaagtaccgacgccaagtcggattttctcgacgaaccc
agtgcatatttaattgagaaaaatgtggctcttcccaaggacatattcggttcgtactta
agttattggatatatgaagttactcgtcataaagcggcagtaattttgctcgtacttatt
gtgacttcaattttattattagtgtttttttataatacggaattttgcgttgcctttgag
atactattgttttccttttgctttccaggaacatgcatggttgtaattgcatttagtgaa
ccgatcggtgatcgggaatttaaagttaagcttctgatggaaattatcacacgtaaaccg
gcggtaaaggggaaagaatggaggacaattacatacaagatgaaccagtatttatttgat
catgggctatgggatactccctactacttttaccgtgatgaagattgccaccgttatttt
ctaagtcttattaagggaagaactttcaagaagcaaaaggaatcgtcagccagcaatgtt
aaagacgcacaatcaaatgacgaaaccgctggcacaccaaacgaagccgctgagtcttct
agttttagtgccggaccgaactttataaagctcctcaccaaggcagccgaaatcgaacaa
caatttcaaaaggaatattggcgacaagagtatcctggtgtcgatgagtttttttag

DBGET integrated database retrieval system