KEGG   Saccharomyces cerevisiae (budding yeast): YBL001CHelp
Entry
YBL001C           CDS       T00005                                 

Gene name
ECM15
Definition
(RefSeq) Ecm15p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiamine_BP
Motif
Other DBs
NCBI-GeneID: 852285
NCBI-ProteinID: NP_009554
SGD: S000000097
UniProt: P35195
Structure
PDB: 

Position
II:complement(237153..237467)
Genome map
AA seq 104 aa AA seqDB search
MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLI
GEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcttttgtttagcggacgtgtgtatggtccctattggcaccgactctgct
agtatttctgattttgttgcactcattgaaaaaaaaatcagagaaagcccattaaagagc
actttacacagtgcaggaacaacaattgaagggccttgggatgatgtgatgggtttgatt
ggcgaaatccatgaatacggtcatgagaaaggatatgttagagtacacactgatattcgt
gttgggactagaactgataagcaccaaactgctcaagataagatcgatgttgttttaaaa
aaaatttctcaatga

DBGET integrated database retrieval system