KEGG   Saccharomyces cerevisiae (budding yeast): YBL004WHelp
Entry
YBL004W           CDS       T00005                                 

Gene name
UTP20
Definition
(RefSeq) Utp20p
  KO
K14772  U3 small nucleolar RNA-associated protein 20
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YBL004W (UTP20)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    YBL004W (UTP20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DRIM DUF3361
Motif
Other DBs
NCBI-GeneID: 852282
NCBI-ProteinID: NP_009551
SGD: S000000100
UniProt: P35194
Position
II:227636..235117
Genome map
AA seq 2493 aa AA seqDB search
MAKQRQTTKSSKRYRYSSFKARIDDLKIEPARNLEKRVHDYVESSHFLASFDQWKEINLS
AKFTEFAAEIEHDVQTLPQILYHDKKIFNSLVSFINFHDEFSLQPLLDLLAQFCHDLGPD
FLKFYEEAIKTLINLLDAAIEFESSNVFEWGFNCLAYIFKYLSKFLVKKLVLTCDLLIPL
LSHSKEYLSRFSAEALSFLVRKCPVSNLREFVRSVFEKLEGDDEQTNLYEGLLILFTESM
TSTQETLHSKAKAIMSVLLHEALTKSSPERSVSLLSDIWMNISKYASIESLLPVYEVMYQ
DFNDSLDATNIDRILKVLTTIVFSESGRKIPDWNKITILIERIMSQSENCASLSQDKVAF
LFALFIRNSDVKTLTLFHQKLFNYALTNISDCFLEFFQFALRLSYERVFSFNGLKFLQLF
LKKNWQSQGKKIALFFLEVDDKPELQKVREVNFPEEFILSIRDFFVTAEINDSNDLFEIY
WRAIIFKYSKLQNTEIIIPLLERIFSTFASPDNFTKDMVGTLLKIYRKEDDASGNNLLKT
ILDNYENYKESLNFLRGWNKLVSNLHPSESLKGLMSHYPSLLLSLTDNFMLPDGKIRYET
LELMKTLMILQGMQVPDLLSSCMVIEEIPLTLQNARDLTIRIKNVGAEFGKTKTDKLVSS
FFLKYLFGLLTVRFSPVWTGVFDTLPNVYTKDEALVWKLVLSFIKLPDENQNLDYYQPLL
EDGANKVLWDSSVVRLRDTIDTFSHIWSKYSTQNTSIISTTIERRGNTTYPILIRNQALK
VMLSIPQVAENHFVDIAPFVYNDFKTYKDEEDMENERVITGSWTEVDRNVFLKTLSKFKN
IKNVYSATELHDHLMVLLGSRNTDVQKLALDALLAYKNPTLNKYRDNLKNLLDDTLFKDE
ITTFLTENGSQSIKAEDEKVVMPYVLRIFFGRAQVPPTSGQKRSRKIAVISVLPNFKKPY
INDFLSLASERLDYNYFFGNSHQINSSKATLKTIRRMTGFVNIVNSTLSVLRTNFPLHTN
SVLQPLIYSIAMAYYVLDTESTEEVHLRKMASNLRQQGLKCLSSVFEFVGNTFDWSTSME
DIYAVVVKPRISHFSDENLQQPSSLLRLFLYWAHNPSLYQFLYYDEFATATALMDTISNQ
HVKEAVIGPIIEAADSIIRNPVNDDHYVDLVTLICTSCLKILPSLYVKLSDSNSISTFLN
LLVSITEMGFIQDDHVRSRLISSLISILKGKLKKLQENDTQKILKILKLIVFNYNCSWSD
IEELYTTISSLFKTFDERNLRVSLTELFIELGRKVPELESISKLVADLNSYSSSRMHEYD
FPRILSTFKGLIEDGYKSYSELEWLPLLFTFLHFINNKEELALRTNASHAIMKFIDFINE
KPNLNEASKSISMLKDILLPNIRIGLRDSLEEVQSEYVSVLSYMVKNTKYFTDFEDMAIL
LYNGDEEADFFTNVNHIQLHRRQRAIKRLGEHAHQLKDNSISHYLIPMIEHYVFSDDERY
RNIGNETQIAIGGLAQHMSWNQYKALLRRYISMLKTKPNQMKQAVQLIVQLSVPLRETLR
IVRDGAESKLTLSKFPSNLDEPSNFIKQELYPTLSKILGTRDDETIIERMPIAEALVNIV
LGLTNDDITNFLPSILTNICQVLRSKSEELRDAVRVTLGKISIILGAEYLVFVIKELMAT
LKRGSQIHVLSYTVHYILKSMHGVLKHSDLDTSSSMIVKIIMENIFGFAGEEKDSENYHT
KVKEIKSNKSYDAGEILASNISLTEFGTLLSPVKALLMVRINLRNQNKLSELLRRYLLGL
NHNSDSESESILKFCHQLFQESEMSNSPQIPKKKVKDQVDEKEDFFLVNLESKSYTINSN
SLLLNSTLQKFALDLLRNVITRHRSFLTVSHLEGFIPFLRDSLLSENEGVVISTLRILIT
LIRLDFSDESSEIFKNCARKVLNIIKVSPSTSSELCQMGLKFLSAFIRHTDSTLKDTALS
YVLGRVLPDLNEPSRQGLAFNFLKALVSKHIMLPELYDIADTTREIMVTNHSKEIRDVSR
SVYYQFLMEYDQSKGRLEKQFKFMVDNLQYPTESGRQSVMELINLIITKANPALLSKLSS
SFFLALVNVSFNDDAPRCREMASVLISTMLPKLENKDLEIVEKYIAAWLKQVDNASFLNL
GLRTYKVYLKSIGFEHTIELDELAIKRIRYILSDTSVGSEHQWDLVYSALNTFSSYMEAT
ESVYKHGFKDIWDGIITCLLYPHSWVRQSAANLVHQLIANKDKLEISLTNLEIQTIATRI
LHQLGAPSIPENLANVSIKTLVNISILWKEQRTPFIMDVSKQTGEDLKYTTAIDYMVTRI
GGIIRSDEHRMDSFMSKKACIQLLALLVQVLDEDEVIAEGEKILLPLYGYLETYYSRAVD
EEQEELRTLSNECLKILEDKLQVSDFTKIYTAVKQTVLERRKERRSKRAILAVNAPQISA
DKKLRKHARSREKRKHEKDENGYYQRRNKRKRA
NT seq 7482 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaagacaaactactaaatcgtctaagcgatatagatattcttccttcaag
gctaggattgacgatttgaagattgaaccggctagaaatttggaaaaaagggtacatgat
tatgtcgagtcgtcgcattttctcgcttcctttgatcagtggaaagaaattaatttaagt
gccaaatttacggagtttgcagcggaaattgagcatgatgttcaaacattaccccaaata
ctatatcatgataaaaagatttttaattctttggtttcattcattaactttcacgatgag
ttttctttgcaaccgcttctggacctcttggctcaattttgtcatgatttaggtccagat
tttcttaaattttatgaagaagctatcaaaactttaataaatctgttagacgctgctata
gaatttgagtcatctaatgtttttgagtggggtttcaactgtttggcttatattttcaag
tatctctcgaaatttttggttaaaaaactggtactcacatgtgatcttttaattccacta
ttgtctcattctaaggaatatctttcaagattttcagcagaagcattatcttttttagta
agaaagtgtcctgtttctaacttgcgcgagtttgttagatcagtttttgaaaagttagag
ggagatgatgagcaaactaacctctacgaagggcttctgatattattcacagaatccatg
acgtcaacgcaagaaactctgcattcgaaagctaaagctatcatgagcgttcttttgcat
gaagctttgaccaaatcatccccggaaagatctgtttcattgctctcagatatttggatg
aacattagtaagtacgcctcaatcgaaagtttacttccagtctatgaagttatgtatcag
gattttaacgattctctcgatgccaccaatatcgatagaatattaaaagtattgacaaca
attgtcttctcggaaagtggtagaaaaattcctgattggaataaaattactatcctaatt
gaaagaataatgagtcaaagtgaaaattgtgcttcgctttcacaggataaagtggctttc
ctatttgctttatttattcgtaacagtgacgtgaaaactttaacattattccaccaaaaa
ctttttaactacgctttaacaaatatatctgactgtttccttgaattctttcaatttgct
ttaaggctaagctatgaaagagtattttcattcaatggattaaaattcctacagttattt
ttaaagaaaaattggcaatcacaaggaaaaaaaattgcacttttttttctagaagtagat
gataagcctgaactgcagaaagtacgggaagtaaatttcccagaagaatttattttatct
atcagagatttttttgtcacagcagaaattaatgattcgaatgaccttttcgaaatatat
tggcgagctataatttttaaatattcgaaattacagaatacagaaattattatcccattg
cttgaacgtatcttttcaacttttgcatcaccagataattttacgaaagatatggtcggt
acactcttaaaaatatatcgtaaagaagacgacgcttcagggaataatctattaaagact
attctggataattacgaaaactataaagaaagtttaaactttttaagaggatggaacaag
ttagtgagtaatcttcatccttcagaaagcttaaaaggactaatgtcacactatccaagt
ctactccttagcttgacagataattttatgttgcctgatgggaagattcgttatgaaact
ttagaattaatgaagacattaatgattttgcagggtatgcaagtacctgacctcctttct
tcatgtatggttatcgaggaaatacctcttacactacaaaatgccagagatttaaccatt
agaatcaagaatgttggtgccgaattcggaaaaaccaaaacagacaagctagtatcctct
ttctttctcaaatacttatttggccttcttaccgttagattctctccagtttggactggt
gtttttgacactcttcctaatgtttacacaaaagatgaagccctcgtttggaaacttgtg
ctatcattcattaaacttcctgatgaaaatcaaaatttggattactaccagcctcttctt
gaagatggtgcaaacaaagttctgtgggattcgagtgtagtgaggttaagggacactatt
gatacgttctcacatatttggtcaaagtattctactcaaaatacgagcattatatctact
actattgaaagaagggggaacaccacctacccaattttaattagaaatcaggctctaaaa
gttatgctatcgattcctcaagttgctgaaaatcacttcgtcgacatcgcaccttttgtt
tataatgacttcaagacttacaaagatgaagaggatatggaaaatgaacgtgttattact
ggttcatggacagaagttgatagaaacgtgtttttaaagactttaagcaagttcaaaaat
ataaagaatgtttatagtgcaacagaattgcacgatcatctgatggtactgttgggtagc
cgtaatacagacgttcagaagcttgcgttggacgcacttcttgcatacaaaaatccaacg
ttgaataaatatagagataatttgaaaaatctactagatgacaccttattcaaggacgag
attacgacttttttaaccgaaaatgggtcgcagtctatcaaggctgaggacgaaaaggta
gtcatgccttatgtccttagaattttcttcggtcgagcacaagtccccccaactagtgga
cagaaaagaagccgcaaaatagctgtcatttcagttttgccaaattttaagaagccatat
attaatgattttttgagtttggctagtgaaaggctggattataattatttttttgggaac
agccatcaaataaatagctcaaaggctaccttgaaaactatcagacggatgactggtttc
gttaacattgtaaattctactctgtctgtattaagaacaaattttcctttgcatactaat
tcagtgctgcagccgttgatctattcaattgctatggcatactatgtcttagatactgag
agcacagaggaggtacatttaagaaagatggcaagtaatttaaggcaacaaggtctaaaa
tgtttaagtagtgtctttgaatttgttggaaatacatttgattggtctacttctatggaa
gatatttacgccgttgtagttaagcctcgtatttcacatttttcggatgaaaacttacaa
caaccctcctctttactaagacttttcctttattgggcacacaatccatctctgtaccag
tttttgtattacgatgaatttgcaactgccactgcattgatggacaccatatcaaaccaa
cacgttaaggaagctgttattggcccaataattgaagcggcggactcaattattagaaat
ccagtaaatgatgatcactacgtagatttggtgactctcatctgcacatcatgtctgaaa
atacttccttcgctatatgtcaaactttctgactcaaactcgatttccacatttttgaat
ttgctagttagtatcactgagatgggatttattcaagatgatcatgttagaagtcgttta
attagttcattaatatcaatattaaaaggaaagctaaaaaaactgcaggaaaatgatacc
caaaaaattttgaaaatattaaagctgatagttttcaactacaattgttcttggagtgat
attgaagaactatacactaccatatcttctttgttcaaaacatttgacgagcgaaacctc
agggtttccttgacagagctcttcatagaactcggtagaaaagttcctgaattagaaagt
atttcgaaattggttgcggacttgaattcatactcctcatcacgtatgcatgaatatgat
tttcctagaattttatcaactttcaaggggttaattgaagatggttataagtcctacagt
gagttagagtggttacctctgttgttcacctttttacattttatcaataataaggaagaa
cttgcgttaagaacaaacgcatcccacgctataatgaagtttattgacttcattaacgaa
aagcctaatcttaatgaagcttcaaaatcgatttctatgctgaaggatatacttttaccc
aatataaggattggcctcagagactccctagaagaggtacaaagtgagtatgtatcagtg
ctatcatatatggtaaaaaacacgaaatatttcaccgacttcgaagatatggccatttta
ctgtacaatggtgatgaagaagcagatttttttacaaacgttaatcatattcagcttcat
cgtcgtcagagagccattaaaagactaggtgaacatgctcatcaactcaaagataacagt
atatcccattatttaattccaatgatcgaacattatgtcttttcggatgatgaaagatac
agaaatattggaaatgagacccaaatagccatcggagggttggcgcagcacatgagttgg
aatcaatacaaagctcttcttagaaggtacatttctatgttgaaaaccaagcctaaccaa
atgaagcaagccgtacaattaattgttcaactttctgttccacttagagaaactcttcgt
atcgtaagagatggggctgagtcgaaacttactttgagcaaatttccttccaacttagat
gaacccagtaattttattaagcaagaattgtatccgactctttcgaaaattcttggcact
agagatgacgaaactataattgaaagaatgcctattgcggaggcattagttaatattgtt
ttagggctcacaaatgatgatattactaatttcctccctagtattctaacaaatatttgc
caagttttgagaagtaaatccgaagaattaagagatgcagtaagagtaaccttgggtaaa
atcagtattatcttgggcgctgagtatcttgtctttgtgataaaggaattaatggctaca
ttaaaacgtggttctcaaattcatgtgttaagttacactgtccactacatattaaagagt
atgcacggagtcttaaaacactccgatttggatacctcgtccagtatgattgttaagatt
ataatggaaaatatctttgggttcgctggtgaagaaaaagactctgagaattatcataca
aaagtgaaagaaattaagagtaataaaagctatgatgctggtgaaattctcgcctcaaac
atcagcctgacagaatttggaacattactctctcctgtgaaggctttgttgatggtcaga
attaatctaagaaatcaaaacaaactgagtgaattattgagacgatatttgttgggttta
aatcataatagtgactctgagtcagaaagtatcctcaagttctgccatcagcttttccag
gaatcagaaatgagtaattcccctcaaataccaaagaaaaaagtgaaagaccaagtagat
gaaaaagaagactttttcttggtaaatttggagtcgaaatcttataccatcaactcaaac
agtttgcttttgaacagcactttacaaaaatttgctttagacttacttaggaacgtaata
acgagacaccgctcctttttaactgtctcgcacctagagggttttattccatttttgaga
gattcgttactttcggaaaatgaaggtgtggtaattagtactttacgtatcctgattaca
ttaattaggctagatttttccgatgaatctagtgaaatcttcaaaaactgtgcgaggaag
gtactaaatattatcaaggtttctccttcaacttcaagcgaattatgccaaatgggttta
aagtttctttctgcctttatacgtcacacagattcaacattaaaggatactgctttgagt
tatgttctagggagggtcttaccagatttaaatgaaccaagcagacaaggccttgctttt
aatttcctaaaagcacttgtttcaaaacatatcatgcttccagaactctatgacattgcg
gatactactagggaaatcatggtcacaaaccactcaaaagaaattagggatgtatccagg
agcgtttactaccaatttttaatggaatatgaccaaagtaagggtcgtttagaaaagcag
ttcaaatttatggtcgacaatttacagtatcctaccgagtccggccgtcagtccgtaatg
gaattgatcaatttgattattacaaaggctaatcctgctttactatccaaattatcatct
tccttctttctggcgctagttaatgtttcttttaatgatgatgcgccaagatgccgtgag
atggcttcagtattgatttccaccatgcttccaaagcttgaaaataaggaccttgaaatt
gttgaaaaatatatagccgcttggctaaaacaggttgataatgcatcctttttaaatctt
gggttgagaacttataaggtctacttgaaaagtattgggtttgaacatactattgagcta
gacgagcttgccatcaagcgtataaggtacattttgagcgatacgtcggtaggatcagaa
catcagtgggatttggtatactcagctttaaatacgttctcatcttatatggaagcaaca
gagagcgtttataaacatggtttcaaagacatatgggatggtattatcacatgtctcttg
tatccgcactcatgggtccgtcaatcggcggcaaatcttgttcatcaactcatagccaat
aaggataagctggagatatcattaaccaatctggaaattcaaaccattgcaacaagaatt
cttcaccaattaggtgcgccttctattccggagaatcttgcgaacgtctcaataaaaaca
ttagttaatatcagtatcctatggaaggagcaacgcacgccgttcataatggatgtatca
aaacaaactggagaggatctaaaatatactaccgccattgattatatggtaactcgaatt
ggtggtattatcaggtcggatgaacatcgtatggattcttttatgtcgaagaaggcgtgt
attcagttattggccttattagttcaagttctggacgaagacgaagtaattgcagaaggg
gaaaagatattattgccgctatatggttatttagaaacatattactcaagagcagttgat
gaagaacaggaagaactacgcactctttcaaacgaatgtttaaaaatactggaagacaaa
ttgcaagtatccgattttacaaaaatatacactgctgtcaaacagaccgtattagaaaga
agaaaggaaaggagatctaaaagggcaattctggctgttaacgctccacaaatttctgct
gataaaaagttgagaaagcatgcgagatcgagggaaaagagaaagcatgaaaaggatgaa
aatgggtattatcaaagacgtaacaaaagaaagagagcctag

DBGET integrated database retrieval system