KEGG   Saccharomyces cerevisiae (budding yeast): YBL006CHelp
Entry
YBL006C           CDS       T00005                                 

Gene name
LDB7, RSC14
Definition
(RefSeq) Ldb7p
  KO
K11764  chromatin structure-remodeling complex protein RSC14
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YBL006C (LDB7)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBL006C (LDB7)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    RSC complex
     YBL006C (LDB7)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   RSC complex
    YBL006C (LDB7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rsc14 zf-met2
Motif
Other DBs
NCBI-GeneID: 852277
NCBI-ProteinID: NP_009547
SGD: S000000102
UniProt: P38210
Position
II:complement(216587..217129)
Genome map
AA seq 180 aa AA seqDB search
MSGSNMGYYDVLAGLSALEKSSQVVFSATELQQLTQQSHATDKGIEGSENSKAKVSKPKR
VAVHGYLGGKVSLADAAQVEYEVGHSLLGSYVPRQQLEALSSVDFSHHFHRTLECKAALE
THDVFLAGAGQLSLPFQSHIESPRNSEAKRKRKVIICKRCQSRFIGSHRRSQLREHACVD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagtaatatgggatactatgacgtactcgcagggctttcagcgctggaaaag
tcatcccaggtagtgttcagtgcgactgagcttcaacagcttacgcaacaatctcatgct
accgacaagggcatagagggcagtgagaatagtaaagcgaaggtatccaagcccaaaaga
gtagctgtacatggttacctaggcggtaaagtgtcgctcgccgatgcggcacaggtggag
tatgaagtaggccattcactgctgggcagttatgtgccacgccagcagttggaagccctg
tcaagtgtcgacttttcgcaccatttccaccgcacattagaatgcaaagctgctctagag
acacacgatgtttttcttgccggcgcaggacaattgtctctacccttccaatcacacata
gagagccccaggaatagcgaggctaaaaggaaaagaaaagtgataatatgcaaacggtgt
caatcacgatttataggttcccataggcggtctcaacttagagaacatgcctgcgtagat
taa

DBGET integrated database retrieval system