KEGG   Saccharomyces cerevisiae (budding yeast): YBL014CHelp
Entry
YBL014C           CDS       T00005                                 

Gene name
RRN6
Definition
(RefSeq) Rrn6p
  KO
K15218  RNA polymerase I-specific transcription initiation factor RRN6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YBL014C (RRN6)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    Transcription initiation factors
     YBL014C (RRN6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrn6
Motif
Other DBs
NCBI-GeneID: 852269
NCBI-ProteinID: NP_009539
SGD: S000000110
UniProt: P32786
Structure
PDB: 

Position
II:complement(199064..201748)
Genome map
AA seq 894 aa AA seqDB search
MSEGQIPSSDVLGSQLGVGVQGASLYCPQENYTTKKQEKPQWLRPVDDTLAEDALDLHIV
VKSLLCDTAIRYISDDKVLQESDADDDLITSDIDEDTDNQGDTSIVVNPVIPVVPKDVHF
FKKVDVGNDSMFGVNCDTPVSFQDYIPSDLLRNLDDTLQESTNSSRPMQDAFFWDPTVAN
RLDSQYIQTASDLRNYRDGTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIELHS
PIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVHSRSCDVMVSSSEPLYFVEIDDL
QVVDFAFNPWDLQQFAIIDIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELSSW
KRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKAWSNIRDYKRIDDKNGILLTSRE
IIIVGASESNDPVRRISWKHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYMHV
FSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLDHIDDESRREEDADENFELVVDFLVK
LRNSSEVYYYALSNTQNSEPNKQETPIIVDHPEWASLFNNADEREKESIGALVSQIKLKE
RERISRVQNLIEHENSHDEDKYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLK
NLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLLHLFLHEDVPGLDIFYNKLLQ
CWVLVSPQAELLTKEIVKDIIWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDI
NEEDESNEFNFDSQFSAPFNGRPPFNLNSQSQIPTIKSSQSSGLARRKRILKTQSQKATP
LSQSTQNLSVLPDSMTPAFTLMQPPSSQISFVNDSQPRNSQKAKKKKKRIRGFG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagggacaaattccaagctcagatgtgttaggctcgcaattgggtgttggtgta
caaggcgccagtctttactgtccgcaagaaaattacactacgaagaagcaagaaaagcca
caatggctaagaccagtagatgatacattggccgaggatgcactagaccttcatatagtg
gtcaaaagtctgctttgtgatactgccataagatatatttccgacgacaaggttttgcaa
gaatcagatgccgacgatgatctcataactagcgatattgatgaagatacggacaatcag
ggggatacatctatagtggtcaatccagtgatacccgtggtaccgaaagatgtccatttt
tttaagaaagttgacgttggtaatgattctatgtttggtgtgaactgcgatacgccagtt
tcatttcaagattacattccttcagatttgctgcgcaacttagatgatacattacaagaa
agtactaactcttcgaggccgatgcaagacgccttcttttgggatcctactgtggctaat
cgactggactctcaatatattcagacagcatcagatttaagaaattatagagacggaacc
gaaatcatagcatatgcctcgggtaaaacaggctcagtcctaaatatagcagttctgaca
cgacaaaatacattgcatttaaaccgacataacaatgtaacgagtatcgaattgcattca
cctatcaagagtattaagataccgggggcctctgagtccatcgggcggagatcaaacctg
gtgggcataatcaccgaaaattctttccaaatctttagaattgaaagtgtccactcaaga
tcatgtgatgtcatggttagtagttcagaaccactgtattttgttgaaatagacgacctt
caggtggtagattttgcattcaatccttgggacttacaacaattcgcaatcattgatata
aaaggtaactggagtatcgggaggataccaaagaatttcaataataataacaaaaggaaa
ctacagttaatagataacctccacggtacgatttttgatccagaagaattatcgtcatgg
aaaagaatagaatggttttcacacttccaaaaaatactggtctttgataggtccaaaatg
attgagatcgactttatgaacaattggcaaacggaagtagtacaagcgaaagcatggtca
aacatacgtgattataagcggatagatgataaaaatggtattttactcacttcaagggaa
ataatcatcgtaggggcatcagaatcaaatgatccagtgagaagaatatcttggaaacac
gatctggatccagatgatactacgctcagaatcactgtacaaaaggttaaaaagcctgac
catattcttctggtggcctttgtatattcgatgcggcataaacgcatctatatgcatgta
ttttcccataggaaagcaaacttgtttcaatccttaggatgctcaacagttcttgaaatt
ccgggtgggacccccaccggtatagagacaatcttaacactggatcatatagacgatgaa
tctcggagagaggaggatgcagatgaaaattttgagttagttgtagattttttagtcaaa
ctaaggaactcatccgaggtttattactatgctttatcaaacactcaaaactccgaaccg
aacaaacaagaaacccccatcattgtcgaccatcccgaatgggcgtcacttttcaataac
gctgatgaacgtgaaaaggagagtatcggtgcactggtttctcaaattaagttgaaggaa
agagagcgcatatctcgagtccaaaatttaattgagcatgaaaacagtcacgacgaagat
aaatatctccaagatttgggatatcgcttatctatagctacaaacgaattgcttgaatct
tggcagaagacgaaagatgaaagcatccttagtgggtctttgagccattcaaaattgaaa
aaccttttggagaattcagattccttcgcgagtatacctgaattttcttcattactagat
cagtttttccagtactatcaggatcaggatgtgacatttattggttttgagaaattgcta
catttgtttttacatgaagacgttccgggcttggatatcttttacaacaaattattgcaa
tgttgggttttggtatccccgcaagcggaactgctgacaaaggagatagtcaaagacatt
atctggagtttagcgagacttgaaaaaccatcactttttgaaccgattcaaaacgaaatt
tcacgatcactaagtggtccttaccaggatattatctcctcttgggatatggatgatatc
aatgaagaagatgaatctaatgaatttaattttgatagtcaattttcagcaccctttaat
ggcaggcctccatttaatttaaattcgcaatctcaaattccaacgatcaaatcatcacaa
agtagcggactggcaaggaggaaaagaatattaaagacacaatcacaaaaagctactccg
ttatcacaatccactcaaaacttaagtgtcctgccagattcaatgacaccagcatttact
ctaatgcagcccccttcctcgcagatatcatttgtgaacgattcacaaccgcgtaattct
caaaaagccaaaaagaagaagaaaaggatccgggggtttggataa

DBGET integrated database retrieval system