KEGG   Saccharomyces cerevisiae (budding yeast): YBL020W
Entry
YBL020W           CDS       T00005                                 
Symbol
RFT1
Name
(RefSeq) glycolipid translocation protein
  KO
K06316  oligosaccharide translocation protein RFT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YBL020W (RFT1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YBL020W (RFT1)
SSDB
Motif
Pfam: Rft-1 MatE
Other DBs
NCBI-GeneID: 852261
NCBI-ProteinID: NP_009533
SGD: S000000116
UniProt: P38206
Position
II:182401..184125
AA seq 574 aa
MAKKNSQLPSTSEQILERSTTGATFLMMGQLFTKLVTFILNNLLIRFLSPRIFGITAFLE
FIQGTVLFFSRDAIRLSTLRISDSGNGIIDDDDEEEYQETHYKSKVLQTAVNFAYIPFWI
GFPLSIGLIAWQYRNINAYFITLPFFRWSIFLIWLSIIVELLSEPFFIVNQFMLNYAARS
RFESIAVTTGCIVNFIVVYAVQQSRYPMGVVTSDIDKEGIAILAFALGKLAHSITLLACY
YWDYLKNFKPKKLFSTRLTKIKTRENNELKKGYPKSTSYFFQNDILQHFKKVYFQLCFKH
LLTEGDKLIINSLCTVEEQGIYALLSNYGSLLTRLLFAPIEESLRLFLARLLSSHNPKNL
KLSIEVLVNLTRFYIYLSLMIIVFGPANSSFLLQFLIGSKWSTTSVLDTIRVYCFYIPFL
SLNGIFEAFFQSVATGDQILKHSYFMMAFSGIFLLNSWLLIEKLKLSIEGLILSNIINMV
LRILYCGVFLNKFHRELFTDSSFFFNFKDFKTVIIAGSTICLLDWWFIGYVKNLQQFVVN
VLFAMGLLALILVKERQTIQSFINKRAVSNSKDV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcgaaaaaaaactcacaattgccctctactagtgagcagatcttggaaaggtccaca
acaggagctaccttcctcatgatgggccaacttttcaccaaactggtaacgttcatacta
aataatttgttgatcaggtttctgtcgcccagaattttcggtatcacggcctttctagaa
tttatacagggcacagtgttattttttagcagagatgcgattcgtctgtcgacgttgaga
atctcagactccggtaatggaataatcgatgatgacgacgaggaggagtaccaggaaact
cattacaagtctaaagttttgcaaaccgcagtcaattttgcttacattccgttttggatc
gggtttccactgtccattggtcttatcgcctggcagtacagaaacatcaacgcgtatttc
atcactcttccattcttcaggtggtcgatttttcttatctggctgagtatcatcgtggag
ctgttaagcgagccattcttcatcgtcaaccagtttatgttgaactatgccgcaaggtca
agatttgaaagcatcgcggtgactacaggatgtattgtcaattttatagttgtttatgcc
gttcagcaatcccgctacccaatgggggttgtcacatcggacattgacaaagaaggcatc
gccatattggcatttgccttgggaaagttagcacattcgatcaccctgctagcatgttac
tactgggactatctcaagaatttcaaaccaaagaaattgttcagtaccaggctaacgaag
ataaaaacgcgtgaaaataacgaattgaagaaaggctacccaaagagcacatcttatttt
ttccaaaacgacattttacagcacttcaaaaaagtttattttcaactatgttttaagcat
ttgttgacagagggtgataagttgattatcaattctttatgtactgtggaagaacaaggc
atttacgctctattgtcgaactatggatcgctactaacaagattattatttgcgccgatc
gaagaatctctgcggttatttttggcccgtttattatcctcgcataaccctaaaaattta
aaactatctattgaagtcctggtgaatttaacaaggttttacatatacttatcgttaatg
atcattgtatttgggcctgccaattcatcctttttattgcagttcttgattggctcgaaa
tggtccactacttccgttttggacactataagagtctactgcttttacatcccattttta
tcgcttaatggtatttttgaagcttttttccagagtgtagccactggtgaccaaattttg
aaacattcatattttatgatggccttttctggtattttcctgctcaattcctggcttctt
attgaaaaactcaaactatcaatcgaaggcttgatattgagtaacatcattaacatggtg
ttgagaatattgtattgtggagttttcttgaataaatttcatagggaactgtttacagat
tcctcttttttcttcaattttaaggatttcaaaacagttattattgctggctcaacgatc
tgtctacttgactggtggtttattgggtacgttaaaaatttacaacaatttgttgttaac
gtattattcgcaatgggattgttagcgttaattttggtcaaggagcgccaaaccatacaa
tcttttattaacaagagggcggtttccaattctaaagatgtataa

DBGET integrated database retrieval system