KEGG   Saccharomyces cerevisiae (budding yeast): YBL027WHelp
Entry
YBL027W           CDS       T00005                                 

Gene name
RPL19B
Definition
(RefSeq) ribosomal 60S subunit protein L19B
  KO
K02885  large subunit ribosomal protein L19e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBL027W (RPL19B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBL027W (RPL19B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YBL027W (RPL19B)
  Archaea
    YBL027W (RPL19B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L19e
Motif
Other DBs
NCBI-GeneID: 852254
NCBI-ProteinID: NP_009526
SGD: S000000123
UniProt: P0CX82 P0CX83
Structure
PDB: 

Position
II:join(168423..168424,168809..169376)
Genome map
AA seq 189 aa AA seqDB search
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttgcgtactcaaaagagacttgccgcttctgttgtcggtgttggtaagaga
aaggtttggttagacccaaacgaaacttctgaaattgcccaagccaactctagaaatgcc
attagaaaattggtcaagaacggaaccatcgtcaagaaggccgttactgtccactctaaa
tctagaactagagcccatgctcaatccaagagagaaggtcgtcacagtggttacggtaag
agaaagggtactagagaagctcgtttaccatcccaagtcgtctggatcagaagattacgt
gtcttgagaagattattggccaagtaccgtgacgctggtaagattgacaagcatttgtac
cacgttttgtacaaggaatccaagggtaacgccttcaagcacaagagagctttggttgaa
cacattattcaagctaaggctgatgctcaacgtgaaaaggctttgaacgaagaagctgaa
gctagaagattgaagaacagagctgctcgtgacagaagagctcaaagagttgctgaaaag
agagacgctttgctaaaggaagacgcttaa

DBGET integrated database retrieval system