KEGG   Saccharomyces cerevisiae (budding yeast): YBL042C
Entry
YBL042C           CDS       T00005                                 

Gene name
FUI1
Definition
(RefSeq) uridine permease
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YBL042C (FUI1)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 852238
NCBI-ProteinID: NP_009511
SGD: S000000138
UniProt: P38196
Position
II:complement(138341..140260)
AA seq 639 aa
MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIEKKDTDSENNI
TIAQDDEKVSWLQRVVEFFEVKNDSTDLADHKPENPIRTFKDLQESLRSTYLYNTDLRPV
EAKRRTWTWKQYIFFWISGSFNVNTWQISATGLQLGLNWWQTWICIWVGYTFVAFFLILG
SKVGNNYHISFPISSRVSFGIYFSIWIVINRVVMACVWNSTLAYIGSQCVQLMLKAIFGT
NLNTRIKDTIKNPNLTNFEFMCFMVFWVACLPFLWFPPDKLRHIFALKSAITPFAAFGFL
IWTLCKAKGHLALGSLNDNGGAISKTVLAWSVIRAIMSALDNFSTLILNAPDFTRFGKTY
KSSVYSQLIALPVCYAIISLIGILSVSAAYTLYGVNYWSPLDILNRYLDNYTSGNRAGVF
LISFIFAFDQLGANLSGNSIPAGTDLTALLPKFINIRRGSYICALISLAICPWDLLSSSS
KFTTALAAYAVFLSAIAGVISADYFIVRKGYVNIFHCYTDKPGSYYMYNKYGTNWRAVVA
YIFGIAPNFAGFLGSVGVSVPIGAMKVYYLNYFVGYLLAALSYCILVYFYPIKGIPGDAK
ITDRKWLEEWVEVEEFGTEREAFEEYGGVSTGYEKIRYI
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgccggtatctgattctggattcgataattcttcaaaaacaatgaaggacgacactata
ccgacggaggattacgaagaaatcacgaaagagtccgagatgggtgatgcgactaaaatt
acttctaagattgatgctaatgtcattgaaaaaaaagataccgattcagaaaacaatata
accattgctcaggatgacgaaaaggtgtcttggctgcaaagagttgtcgagttttttgag
gttaagaatgactctaccgatttggccgatcataagcccgaaaatccaattaggacattt
aaagatttacaggagtccctccgttcgacgtacttgtacaacacagatctgcggcccgtg
gaggcaaaaagaagaacgtggacatggaagcagtacattttcttttggatttctgggtcc
tttaacgtcaatacatggcaaatctcagccactgggctacagttagggcttaactggtgg
cagacttggatctgtatttgggttggatacacgtttgtcgcatttttcttgatactgggt
tccaaagtggggaacaattaccatatctctttccccatttcctcaagagtatcatttggt
atctacttctccatctggattgtcatcaaccgtgtcgtcatggcatgtgtctggaattct
actttggcttatatcggtagtcaatgtgttcagttgatgctaaaggctatcttcggtact
aatttgaatactagaatcaaagacaccataaagaaccccaatttgacgaacttcgagttc
atgtgcttcatggtcttctgggtcgcatgtttaccgttcctatggtttccacctgacaaa
ttgcgtcatatatttgcactcaaatccgccatcactccatttgcggccttcggttttttg
atttggactctttgtaaggccaaaggtcatttggcattgggttccctaaatgacaatggt
ggcgcaatcagcaagacggttttagcatggtctgtcattagagctattatgagtgctctg
gataacttctctactttaatcctaaacgctcctgacttcactagattcggtaagacctac
aagtcatctgtttactcgcaattgattgcgctacccgtctgctatgccattatttcctta
atcggaatattgtctgtctccgcagcttatacattgtacggagtaaattattggagtccc
ctagacattctgaacaggtacttggataactatacttcggggaacagagccggtgtattc
ttaatatctttcatttttgcgtttgaccagctgggtgccaacttgtctggtaactcgatc
cctgcaggtaccgatctgactgcattattgcctaaattcatcaatatcagacgcggttct
tatatttgtgctctaatatcgttggcgatttgcccctgggatttattatcatcatcgtca
aagtttactacggcactagcggcatatgcagttttcttaagtgctattgcgggtgtaata
tcagccgattacttcattgtcagaaagggttacgttaatattttccattgctacaccgac
aagccaggatcgtactacatgtacaataaatatggtacgaactggagggcggtggtagct
tatatatttggtattgctcctaattttgcaggctttttaggttcagtgggagtttctgtg
cctattggcgctatgaaagtttactacctaaactatttcgttggttatctccttgcagca
ttgagttactgcattttagtgtatttttacccaattaagggtattccaggcgatgccaag
ataactgaccgtaaatggctcgaagagtgggtcgaagtagaagaattcggaactgaaaga
gaagcttttgaagaatatggcggcgtttccactggctatgaaaagatacgatatatctaa

DBGET integrated database retrieval system