KEGG   Saccharomyces cerevisiae (budding yeast): YBL064C
Entry
YBL064C           CDS       T00005                                 

Gene name
PRX1
Definition
(RefSeq) thioredoxin peroxidase PRX1
  KO
K24137  glutaredoxin/glutathione-dependent peroxiredoxin [EC:1.11.1.25 1.11.1.27]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YBL064C (PRX1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.25  glutaredoxin-dependent peroxiredoxin
     YBL064C (PRX1)
    1.11.1.27  glutathione-dependent peroxiredoxin
     YBL064C (PRX1)
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin
Other DBs
NCBI-GeneID: 852215
NCBI-ProteinID: NP_009489
SGD: S000000160
UniProt: P34227
Structure
PDB: 
5YKJ

Position
II:complement(100371..101156)
AA seq 261 aa
MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDA
DTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDV
ESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVI
DPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE
AKAKFGQFNEIKPYLRFTKSK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtttagtagaatttgtagcgctcaattaaagaggacggcatggacccttcctaagcag
gctcacttgcaatcacagacgattaaaacatttgccacagcacctattctgtgcaaacaa
ttcaaacaaagtgatcaaccaagactaagaataaactctgatgctcctaactttgatgct
gacacaacggttggtaaaatcaatttttacgactacttgggcgactcttggggggtcttg
ttttctcacccagcagatttcacccctgtctgcaccaccgaagtcagcgcattcgccaaa
ttgaagccggaattcgacaagagaaatgttaaattgatcgggctttcagtggaagatgtt
gagtcccacgaaaaatggattcaagacatcaaggaaatagcaaaggttaaaaatgttggt
ttcccaataattggtgacacttttagaaacgtggcattcctatatgatatggtagatgcc
gaaggattcaaaaatatcaatgatgggtcactgaagaccgtgaggtctgttttcgtcatc
gatcccaagaagaagattagactgatttttacctacccttccaccgtcggaagaaacact
tctgaagtgttaagggtaatcgacgccttgcaattgactgacaaggagggcgtagtaact
ccaattaattggcagccagctgacgatgtcattattcctccctctgtctccaatgatgag
gcgaaggctaaatttggtcaatttaatgaaattaaaccctatttaagattcaccaagtcg
aaataa

DBGET integrated database retrieval system