KEGG   Saccharomyces cerevisiae (budding yeast): YBL072CHelp
Entry
YBL072C           CDS       T00005                                 

Gene name
RPS8A
Definition
(RefSeq) ribosomal 40S subunit protein S8A
  KO
K02995  small subunit ribosomal protein S8e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YBL072C (RPS8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YBL072C (RPS8A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YBL072C (RPS8A)
  Archaea
    YBL072C (RPS8A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S8e
Motif
Other DBs
NCBI-GeneID: 852206
NCBI-ProteinID: NP_009481
SGD: S000000168
UniProt: P0CX39 P0CX40
Structure
PDB: 

Position
II:complement(88523..89125)
Genome map
AA seq 200 aa AA seqDB search
MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRI
ETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQT
LGKKKNVKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQSGRCD
GYILEGEELAFYLRRLTAKK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttctcgtgattctcgtcacaaaagatccgctaccggtgccaagcgtgctcaa
ttcagaaagaagagaaagttcgaattaggccgtcaaccagccaacaccaagatcggtgct
aagagaattcactctgttagaactagaggtggtaacaagaaatacagagctctaagaatt
gaaaccggtaacttttcttgggcttctgaaggtatctccaagaagaccagaattgctggt
gttgtttaccatccatccaacaatgaattggttagaactaacactttgaccaaggctgcc
attgtccaaattgatgctactccattcagacaatggttcgaagctcactacggtcaaacc
ttgggtaagaagaagaacgtcaaggaagaagaaactgttgccaagagcaagaacgctgaa
agaaagtgggctgctagagctgcttctgccaagatcgaatcttccgttgaatctcaattc
agcgccggtagattatacgcttgtatctcttccagaccaggtcaatccggtagatgtgat
ggttacatcttggaaggtgaagaattagctttctacctaagaagattgactgctaagaaa
tag

DBGET integrated database retrieval system