KEGG   Saccharomyces cerevisiae (budding yeast): YBL078CHelp
Entry
YBL078C           CDS       T00005                                 

Gene name
ATG8, APG8, AUT7, CVT5
Definition
(RefSeq) ubiquitin-like protein ATG8
  KO
K08341  GABA(A) receptor-associated protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YBL078C (ATG8)
   04136 Autophagy - other
    YBL078C (ATG8)
   04139 Mitophagy - yeast
    YBL078C (ATG8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YBL078C (ATG8)
   04121 Ubiquitin system [BR:sce04121]
    YBL078C (ATG8)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBL078C (ATG8)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    YBL078C (ATG8)
Ubiquitin system [BR:sce04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   YBL078C (ATG8)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    YBL078C (ATG8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 852200
NCBI-ProteinID: NP_009475
SGD: S000000174
UniProt: P38182
Structure
PDB: 

Position
II:complement(80378..80731)
Genome map
AA seq 117 aa AA seqDB search
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQF
VYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctacatttaagtctgaatatccatttgaaaaaaggaaggcggagtcggagagg
attgctgacaggttcaagaataggatacctgtgatttgcgaaaaagctgaaaagtcagat
attccagagattgataagcgtaaatatctagttcctgctgaccttaccgtagggcaattt
gtttatgttataagaaagagaattatgctaccccctgagaaggccatcttcatttttgtc
aatgatactttgccacctactgcggcgttgatgtctgccatatatcaagaacacaaggat
aaggacgggtttttgtatgtcacttactcaggagaaaatacatttggcaggtag

DBGET integrated database retrieval system