KEGG   Saccharomyces cerevisiae (budding yeast): YBL079WHelp
Entry
YBL079W           CDS       T00005                                 

Gene name
NUP170, NLE3
Definition
(RefSeq) Nup170p
  KO
K14312  nuclear pore complex protein Nup155
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBL079W (NUP170)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YBL079W (NUP170)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YBL079W (NUP170)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleoporin_N Nucleoporin_C
Motif
Other DBs
NCBI-GeneID: 852199
NCBI-ProteinID: NP_009474
SGD: S000000175
UniProt: P38181
Structure
PDB: 

Position
II:75259..79767
Genome map
AA seq 1502 aa AA seqDB search
MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQPTHILNSYPI
TGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPV
LDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELN
RCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMEL
FMFAISLDKATNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSG
SDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLT
IDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKI
VKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIQQE
LLHQQQEQAKRSFPFFSNLMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQ
QTHQQEKKENSSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLE
TAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFE
DLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRY
SVSTVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRL
LRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIE
YYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMV
QSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTK
SLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRN
YDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLA
CQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVK
LRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNIL
WVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLAS
RIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEI
ALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQD
SEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSD
NSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFY
KE
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaagttttttccacaacaatgggcccgctgctgccggtgaaacgttttcagat
agcagatcgtaccctttaacgaatcatcaagaagtacccaggaatggactgaatgagttg
gcctcatctgcaaccaaggcgcaacaacaacctacacacatattaaactcatatccaatt
accgggtccaacccactcatgagggcaagcgcaatgggggcgacctctggcagcatcaat
cctaatatgtccaacatgaatgagcacattcgtgtttccgggatggggacttctaagccc
ctggacttagcgggaaagtacattgaccatctacaacataaagatagtaacactcccgta
ctcgacgaacgatcttattataacagcggggtagattataacttcagcagagaaaaaaac
ggcttaggagcgtttactccatttgaaaagcaagatgtgttcaacattccggacgagatt
ttgcatgaattttccacttcacagacaaaaactgatatgggtattttcccggagttaaat
cgatgttggataactattgataataaactgatactctggaatattaacaatgacaatgag
tatcaggtggtagatgatatgaagcataccattcaaaaagtcgccttggtaagacctaag
ccaaacacctttgtgcctgccgtgaagcatctacttttgataagcacgacaatggagctt
ttcatgtttgctatttccttagacaaagccaccaacgaactcagtgtattcaatacacat
ctatcagtccctgtacaaggcattgatgtaatagacattgtgtctcatgaaagatcgggt
agaattttcttcgcaggccaagccagtggcctgaatatctgggagttgcactactcaggt
tccgatgactggttcaatagtaaatgtagtaaggtctgtctgacaaagtctgccctatta
agtcttctacctactaacatgttatcgcagattccaggtgttgattttattcaggctttg
ttcgaagataattctaacggtaatggcggattttctcaagagaccatcacgcaactaact
attgaccaacaaagaggaatcatctattcattatcctccaaatccaccattagagcatac
gtaataacagaaaaatcactggaaggacccatgtcaattgagcctgcctacatcagtagg
atcataggtaccacgacggcaagggcagcaccgattttgggccccaaatacctaaaaatt
gtcaagataagctctgttgcaccagaagaaaacaacaatttgtttttagttgctttaaca
gtaggtggtgtgcgtttgtactttaatggttccatgggcagatttaacatcgaagctttg
aggttagaatcgatcaagttcccccctagttctgtaactcctgaagtcatccaacaagaa
ttactacatcaacaacaggaacaggcgaagagaagctttcctttcttttcaaatctaatg
tcttccgaaccagtcctcttaaaattccaaaagaaatcatctgtattactagagactaca
aaagcaagtacaattatttccccaggcatatttttttccgctgtgatcaagtcatctcag
caaactcatcaacaagaaaaaaaagagaactcatctgttactggaacgaccgctaccgca
gggtctaaaactgtcaaacaacagccagttactttacaacataagcttttcgttagtgtt
ccagattatggtatcttgaaaacacacggtaagtacgttgaaaatgccacgtttttggaa
actgcgggcccagttcaacaaattattcccttatcggggttgtttaatgcaacgacaaag
ccacaaggatttgctaacgaatttgcgacacagtacacatcagaaactttaagggtagca
gttttgacgagcacttctatcgaaatttataaatatcgtactcctgatgaaatttttgag
gatctaatcgataatccgctgccattcgtcttaaattatggtgccgcggaagcttgttcc
actgcattgtttgttacttgcaaatcaaataaatctgaaaaattaagatctaatgccctg
acttttttaactatgggtattcctggcgttgttgacatcaaacctgtctacaaccgttat
tctgtatctacagtatcctctttattgtcaaagcccactttatcaaccgcaacaactaat
ctccaacaatcaataactggctttagtaaaccctcccctgcaaacaaggaagattttgac
ttagatgacgtaatattatcccccagattttacggtattgcattattgattaccagacta
cttcgagatatttgggggagacatgtcttcatgacttttacagataatagggtgacatcc
catgctttcatttcttcttctgatccaatcactccatctattaataacctaaaaagtgat
gaaatttcacaaaataggaacataatatcaaaggtttctatttccaaggattgtatcgag
tactatctatcttcaattaacattttaaatgaatttttcatcacttatggtgattcaatt
tcccaaatatcagctccctacgtattagcgaacaattctaacggcagggttattgataaa
acagaagaagttgcaaaccaagcggaaagtatagcgattaatgcgatgatcaaaatggta
cagtccataaaggaaggtctatcattcttgaacgttttatacgaggaaagcgaagtcgaa
ggattcgacaaccaataccttggtttcaaggatataatcagttttgtaagcttggacgtc
caaaaagatttagtcaaactagattttaaagatttatttgctccaaatgacaaaacaaaa
tcattaattagagaaattttattatccatcatcaataggaatatcaccaaaggtgcgtcg
atagagtataccgcaacagctttacaagaacgctgtggatcattctgctctgcaagtgat
atattaggatttagagccattgaacatcttagaagggctaaagaaattggcttgcgtaac
tatgattctctaaactatcacctgaaaaatgctactgctttacttgaacaaattgtggat
gatctttctatcgagaaattgaaagaagctgtatcaatgatgctgagtgtaaattattac
ccaaaatctattgaattcttattgaatattgccaactctatggacaaaggcaaactagct
tgtcaatatgtggcaaatggatttttagaaaatgatgataggaaacaatattacgacaaa
cgtatcttagtttatgacctagtttttgatactttaataaaagtagacgaacttgccgaa
aaaaaacagtcatcaaaaactcaaaaccaaatttcgatatcgaatgacgatgaagtgaaa
ctgagacaaaaaagttatgaagccgccctaaaatataacgatagattattccactatcat
atgtatgattggcttgtgtctcagaacagagaggaaaaactattagatattgaaactcca
ttcatactcccttatttaatggaaaaggcaggtagttcattgaagatatctaatatactc
tgggtctattattcaagaagatctaaatttttcgaatctgctgaaattctttaccgttta
gctacatcgaattttgacatcacattgtttgaaagaattgagtttctttcacgcgccaat
ggtttttgcaacagtgtgtcaccattaagccagaaacaaagaattgtacaattagctagt
aggatccaagatgcatgtgaagttgctggtattcaaggtgatatattgtcgctcgtgtat
acagacgcaagaatagattcagccattaaagatgagctgatcaaaactctagatggtaaa
atattgagcacaagtgagctgtttaatgattttgctgtacccttaagttaccatgaaatt
gccctattcattttcaagatagcagattttagggaccatgaagtaattatggccaagtgg
gatgagctattccaatctttgaggatggaatttaataataccggaaagaaagaagattca
atgaacttcatcaacttactgtctaatgtactgattaaaattggtaaaaatgttcaggat
tctgaattcattttccccattttcgaactctttcccattgtctgtaattttttctacgaa
acactacctaaggaacatattgtatcagggtcgatagtttctatattcataacagcgggt
gtttctttcaacaaaatgtactatattttaaaagaactaatcgagacatcagattccgat
aattccgtatttaataaagaaatgacctggttaattcacgaatggtacaaatcggacagg
aaatttagggacattatttcctacaacgatatcattcacttgaaggaatacaaaattgat
aatgatccaattgaaaagtacgttaagaacagcggcaataatttggggatttgtttctac
aaagaataa

DBGET integrated database retrieval system