KEGG   Saccharomyces cerevisiae (budding yeast): YBL080CHelp
Entry
YBL080C           CDS       T00005                                 

Gene name
PET112
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit PET112
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00970  Aminoacyl-tRNA biosynthesis
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YBL080C (PET112)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBL080C (PET112)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YBL080C (PET112)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YBL080C (PET112)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YBL080C (PET112)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 852198
NCBI-ProteinID: NP_009473
SGD: S000000176
UniProt: P33893
Structure
PDB: 

Position
II:complement(73070..74695)
Genome map
AA seq 541 aa AA seqDB search
MLRLARFYSLARTKAIHSHGAPFRPEYALKCGLEIHTQLNTKNKLFSQSTNSATSLVDAP
NHHTSYYDIALPGTQPVLNLEAILFAMKLSLALGSQVNSISQFDRKHYFYGDQPQGYQLT
QHYRPFARGGKINLSKELDDIDESAKEIGILQLQIEQDTGKSHYTETDKDVITLVDLNRS
NVPLIELVTKPDFSDIKQVRAFIKKYQNLVRHLHISSGDLETGAMRVDVNLSINEYARVE
LKNLPNTSSIINAIKYEYQRQVELISVGDTSSLMEPETRGWTGSSTVKLRSKETTIDYRY
MPDPELPYINLAPDVISGVRGLMPQLPDDIMRILMKKPYQLSLKDAKILTYNSNQNDMYN
HEALRSYYLDTFREFSKLAGERSNAKLPTNWIIHEFLGDLNKLQIPLAKAKEILPPPVFA
QFLKLLHEEVISATSGKMLLFHILENFEQSNCQDLSIPDFSKLIEKFELHAINQVDPQEL
MDLCNDVIAQHTDDTFIRNLVTGKKKSSLKFLIGQGMRRSQGRIKANEFEKKFKEILNIQ
W
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggcttgcacgtttttattctttggccagaaccaaagccatacatagtcacggt
gcacccttcaggccggaatatgcattgaagtgtggattggagattcatacgcaattgaac
accaaaaacaagcttttttcacaatcaacgaatagcgccacatctctagtggatgcacca
aaccatcatactagttattatgacatagctctaccgggaacgcagccggttttgaatctg
gaagcaatcttgtttgccatgaaactatccttggcactgggttctcaagtgaatagcata
tctcagtttgataggaagcattatttttatggagatcaacctcaaggctatcaactgacg
cagcactacaggccgtttgctcggggtgggaagatcaatctgtcgaaggaattggatgat
atcgatgaatcagccaaggaaatcggtatcttacagttgcagatagagcaggacacgggg
aagtcacactatacagagacagataaagacgttattactttggttgatttaaataggtcg
aacgtcccgcttatcgaattggtaactaaaccagatttcagtgatattaaacaggttaga
gcgtttattaaaaaatatcagaatttggtacgtcatttgcacatttcctctggggacctg
gaaacgggcgccatgcgagtggacgttaacctctcaattaatgaatatgcacgcgttgag
ttgaagaatttacccaatactagttccatcatcaatgcaatcaagtacgaatatcagcgg
caagttgagttgatttctgtgggtgacactagctcactgatggagccagaaacaaggggc
tggacaggctcatcaacggtgaagttgagaagcaaagaaaccacgatcgattacaggtac
atgcctgatccagaattgccgtatatcaacctcgcaccagacgttatcagtggtgtgaga
gggttgatgccccaattaccggacgatataatgagaattcttatgaagaaaccctatcaa
ttatcattgaaggacgccaagattctgacttataatagtaaccaaaacgatatgtacaat
catgaggcgttgagatcgtactacttagacaccttccgtgaattttccaagcttgctggt
gaacgtagtaacgcgaaattacctacgaattggataatccatgaattcttgggagatttg
aacaagctacaaattccattggccaaagcaaaagaaattttgcctcctccggttttcgcc
cagtttttgaagttattgcatgaagaggttatatccgcaactagtggtaaaatgttactg
tttcacatattggaaaatttcgagcagagtaactgccaagatttgtctattccagatttt
tcaaaactaatcgagaaatttgaattgcatgcgattaatcaggtcgaccctcaagaattg
atggatctctgtaatgatgtcattgcacagcacacagatgacacttttatacggaacctg
gttactggtaaaaagaagtcctctttaaaattcctaattggacaaggaatgagacgaagc
cagggacgtataaaggcaaacgaattcgagaaaaaattcaaagagatcttaaatattcaa
tggtaa

DBGET integrated database retrieval system