KEGG   Saccharomyces cerevisiae (budding yeast): YBL082CHelp
Entry
YBL082C           CDS       T00005                                 

Gene name
ALG3, RHK1
Definition
(RefSeq) dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichol alpha-1,3-mannosyltransferase
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
Module
sce_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YBL082C (ALG3)
   00513 Various types of N-glycan biosynthesis
    YBL082C (ALG3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YBL082C (ALG3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     YBL082C (ALG3)
Glycosyltransferases [BR:sce01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   YBL082C (ALG3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALG3
Motif
Other DBs
NCBI-GeneID: 852196
NCBI-ProteinID: NP_009471
SGD: S000000178
UniProt: P38179
Position
II:complement(69751..71127)
Genome map
AA seq 458 aa AA seqDB search
MEGEQSPQGEKSLQRKQFVRPPLDLWQDLKDGVRYVIFDCRANLIVMPLLILFESMLCKI
IIKKVAYTEIDYKAYMEQIEMIQLDGMLDYSQVSGGTGPLVYPAGHVLIYKMMYWLTEGM
DHVERGQVFFRYLYLLTLALQMACYYLLHLPPWCVVLACLSKRLHSIYVLRLFNDCFTTL
FMVVTVLGAIVASRCHQRPKLKKSLALVISATYSMAVSIKMNALLYFPAMMISLFILNDA
NVILTLLDLVAMIAWQVAVAVPFLRSFPQQYLHCAFNFGRKFMYQWSINWQMMDEEAFND
KRFHLALLISHLIALTTLFVTRYPRILPDLWSSLCHPLRKNAVLNANPAKTIPFVLIASN
FIGVLFSRSLHYQFLSWYHWTLPILIFWSGMPFFVGPIWYVLHEWCWNSYPPNSQASTLL
LALNTVLLLLLALTQLSGSVALAKSHLRTTSSMEKKLN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgaacagtctccgcaaggtgaaaagtctctgcaaaggaagcaatttgtcaga
cctccgctggatctgtggcaggatctcaaggacggtgtgcgctacgtgatcttcgattgt
agggccaatcttatcgttatgccccttttgattttgttcgaaagcatgctgtgcaagatt
atcattaagaaggtagcttacacagagatcgattacaaggcgtacatggagcagatcgag
atgattcagctcgatggcatgctggactactctcaggtgagtggtggaacgggcccgctg
gtgtatccagcaggccacgtcttgatctacaagatgatgtactggctaacagagggaatg
gaccacgttgagcgcgggcaagtgtttttcagatacttgtatctccttacactggcgtta
caaatggcgtgttactaccttttacatctaccaccgtggtgtgtggtcttggcgtgcctc
tctaaaagattgcactctatttacgtgctacggttattcaatgattgcttcactactttg
tttatggtcgtcacggttttgggggctatcgtggccagcaggtgccatcagcgccccaaa
ttaaagaagtcccttgcgctggtgatctccgcaacatacagtatggctgtgagcattaag
atgaatgcgctgttgtatttccctgcaatgatgatttctctattcatccttaatgacgcg
aacgtaatccttactttgttggatctcgttgcgatgattgcatggcaagtcgcagttgca
gtgcccttcctgcgcagctttccgcaacagtacctgcattgcgcttttaatttcggcagg
aagtttatgtaccaatggagtatcaattggcaaatgatggatgaagaggctttcaatgat
aagaggttccacttggcccttttaatcagccacctgatagcgctcaccacactgttcgtc
acaagataccctcgcatcctgcccgatttatggtcttccctgtgccatccgctgaggaaa
aatgcagtgctcaatgccaatcccgccaagactattccattcgttctaatcgcatccaac
ttcatcggcgtcctattttcaaggtccctccactaccagtttctatcctggtatcactgg
actttgcctatactgatcttttggtcgggaatgcccttcttcgttggtcccatttggtac
gtcttgcacgagtggtgctggaattcctatccaccaaactcacaagcaagcacgctattg
ttggcattgaatactgttctgttgcttctattggccttgacgcagctatctggttcggtc
gccctcgccaaaagccatcttcgtaccaccagctctatggaaaaaaagctcaactga

DBGET integrated database retrieval system