KEGG   Saccharomyces cerevisiae (budding yeast): YBL085WHelp
Entry
YBL085W           CDS       T00005                                 

Gene name
BOI1, BOB1, GIN7
Definition
(RefSeq) Boi1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PH SAM_2 SH3_1 SH3_9 PH_8 SAM_1 SH3_2 PH_11 SAM_3
Motif
Other DBs
NCBI-GeneID: 852193
NCBI-ProteinID: NP_009468
SGD: S000000181
UniProt: P38041
Position
II:63876..66818
Genome map
AA seq 980 aa AA seqDB search
MSLEGNTLGKGAKSFPLYIAVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLR
TKEEGLYPAVFTKRIAIEKPENLHKSPTQESGNSGVKYGNLNDSASNIGKVSSHQQENRY
TSLKSTMSDIDKALEELRSGSVEQEVSKSPTRVPEVSTPQLQDEQTLIQEKTRNEENTTH
DSLFSSTADLNLSSESLKNISKSNISTKSLEPSSESVRQLDLKMAKSWSPEEVTDYFSLV
GFDQSTCNKFKEHQVSGKILLELELEHLKELEINSFGIRFQIFKEIRNIKSAIDSSSNKL
DADYSTFAFENQAAQLMPAATVNRDEIQQQISSKCNKLSSESSDRKSSSVTTELQRPSSV
VVNPNFKLHDPAEQILDMTEVPNLFADKDIFESPGRAPKPPSYPSPVQPPQSPSFNNRYT
NNNARFPPQTTYPPKNKNPTVYSNGLIPNSSTSSDNSTGKFKFPAMNGHDSNSRKTTLTS
ATIPSINTVNTDESLPAISNISSNATSHHPNRNSVVYNNHKRTESGSSFVDLFNRISMLS
PVKSSFDEEETKQPSKASRAVFDSARRKSSYGHSRDASLSEMKKHRRNSSILSFFSSKSQ
SNPTSPTKQTFTIDPAKMTSHSRSQSNSYSHARSQSYSHSRKHSLVTSPLKTSLSPINSK
SNIALAHSETPTSSNNKEAVSQPSEGKHKHKHKHKSKHKHKNSSSKDGSSEEKSKKKLFS
STKESFVGSKEFKRSPSELTQKSTKSILPRSNAKKQQTSAFTEGIRSITAKESMQTADCS
GWMSKKGTGAMGTWKQRFFTLHGTRLSYFTNTNDEKERGLIDITAHRVLPASDDDRLISL
YAASLGKGKYCFKLVPPQPGSKKGLTFTEPRVHYFAVENKSEMKAWLSAIIKATIDIDTS
VPVISSYATPTIPLSKAQTLLEEARLQTQLRDAEEEEGRDQFGWDDTQNKRNSNYPIEQD
QFETSDYLESSAFEYPGGRL
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgaaggaaataccctaggcaaaggggccaaatcttttcctctgtatattgcg
gtaaatcagtactctaaacgaatggaggacgagctcaatatgaaaccaggtgataaaatt
aaagtcattactgatgatggggagtacaatgacggctggtattatgggcgcaatttgaga
accaaagaggaaggtttatacccagcggtatttaccaaaagaatagcaatagaaaaacca
gagaacctgcacaaatcaccaacccaagagagtggaaattctggtgttaaatatggaaat
ttaaatgattctgcgagtaacataggtaaagtctcctcgcatcaacaggagaacagatat
acatcattgaaaagtacaatgagcgatatagacaaagccttggaagagctaagaagtggt
tcagttgaacaagaggtatcaaaatcgcccacacgcgtgcccgaagttagcactccacag
ttgcaagatgaacagactttgattcaagaaaaaaccagaaatgaggaaaacacgacacat
gactcgttattttctagcacagcggatttaaacttaagttctgaatctttgaagaatata
agtaagtcaaatatatcaacaaaatccctagaaccgagttcggaatcagttcgtcaatta
gatttgaaaatggctaaaagttggagcccagaagaggttactgattactttagcttggtt
ggatttgatcaatccacttgcaataaattcaaagagcatcaagtctccggaaaaatacta
ctggaattagaactggaacacctaaaagaattggaaataaattcttttggtataagattt
cagatattcaaagaaataaggaacatcaagtctgcaattgattcgtcgtcaaataaactg
gacgccgactactctacctttgcttttgaaaaccaagctgcccaactaatgcctgcagcc
actgtaaatagagacgaaatccaacaacaaatttcctccaagtgtaacaagttgtcaagt
gaaagctctgatagaaaatcatcttcggtcaccacagaattgcaaagaccaagctcggtt
gttgttaatcccaattttaaacttcacgacccagctgagcagatcctagatatgacagaa
gttcctaatttgtttgctgataaagatattttcgaatcaccgggaagggctccaaaacca
ccatcatatccaagtccagttcaacctccacaatcgccctcttttaataacaggtacaca
aataataacgcaaggtttcctcctcaaacaacatatccacctaaaaacaagaacccaacc
gtttattcaaatgggctaattccaaattcttcgacatcttccgataattcaacgggcaag
ttcaaattccctgccatgaatggtcatgactcgaactctaggaaaacaacactgacatct
gctactataccttctattaacacggttaacacagatgaatctctacccgcaatttcaaat
atatcttcaaatgctacatctcatcatccgaacagaaattccgttgtttacaataaccat
aagaggacggaatccggaagctcatttgttgatttgttcaacaggatttcaatgctatcg
ccagtcaagtcaagtttcgacgaagaagaaacgaaacaaccttcaaaagctagcagagca
gtttttgactcagcacgcagaaagtcgtcttacggacattcaagagatgcctcactttct
gaaatgaaaaagcataggagaaactcttctatattatcttttttttcttcaaaaagtcag
tctaatccaacgtcaccaaccaaacaaactttcactatcgatcccgcaaagatgacttcc
cattctcgttctcagtcgaattcctattcgcatgcaagatcacaatcttactcccatagt
agaaaacactcgttagttaccagccccttgaaaacttctttaagccctataaattccaaa
tccaatattgctttagcgcatagcgaaactcctactagtagtaataataaggaggcagta
tcacaaccaagtgaagggaagcacaagcacaagcacaagcacaagagcaagcacaaacac
aagaacagtagctccaaagatggctcttccgaagaaaaaagcaaaaagaaattatttagt
agcaccaaagaatcatttgtaggaagcaaggaattcaaaagatctcccagtgaacttacc
caaaaatctaccaaatcgatacttcccaggtcgaatgctaaaaagcaacaaacatctgct
tttaccgaaggtatacgctctatcacagcaaaggaatctatgcaaactgcggactgttca
ggctggatgagcaaaaaaggtaccggtgctatggggacttggaaacaacggtttttcaca
cttcatggaacaaggctttcttattttacgaataccaatgatgagaaggagcgtggcctg
atagatataacggcacatagggtcttacctgccagtgatgatgataggctcatttcctta
tacgctgcgagcttaggaaaaggaaaatactgtttcaaattggtccctccgcaaccgggg
tccaaaaaggggctaacctttacagaacctcgcgttcactattttgcagttgagaataaa
tctgaaatgaaggcatggctgtcagccataataaaggccactattgatattgatacaagc
gtccctgtcattagttcatatgccacaccaacgatacctctaagcaaggcacagacgcta
ttggaagaagctaggttacaaacccagttaagagatgctgaagaggaagagggaagagat
caatttggatgggatgacacccaaaataaaagaaattctaattatccaatcgaacaagat
caatttgagaccagcgattacctggaaagttcagcatttgaataccctggtggcagactt
tga

DBGET integrated database retrieval system