KEGG   Saccharomyces cerevisiae (budding yeast): YBL088CHelp
Entry
YBL088C           CDS       T00005                                 

Gene name
TEL1
Definition
(RefSeq) DNA-binding protein kinase TEL1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Module
sce_M00691  DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YBL088C (TEL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YBL088C (TEL1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBL088C (TEL1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBL088C (TEL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YBL088C (TEL1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   YBL088C (TEL1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     YBL088C (TEL1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    YBL088C (TEL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC
Motif
Other DBs
NCBI-GeneID: 852190
NCBI-ProteinID: NP_009465
SGD: S000000184
UniProt: P38110
Position
II:complement(51019..59382)
Genome map
AA seq 2787 aa AA seqDB search
MEDHGIVETLNFLSSTKIKERNNALDELTTILKEDPERIPTKALSTTAEALVELLASEHT
KYCDLLRNLTVSTTNKLSLSENRLSTISYVLRLFVEKSCERFKVKTLKLLLAVVPELMVK
DGSKSLLDAVSVHLSFALDALIKSDPFKLKFMIHQWISLVDKICEYFQSQMKLSMVDKTL
TNFISILLNLLALDTVGIFQVTRTITWTVIDFLRLSKKENGNTRLIMSLINQLILKCHCF
SVIDTLMLIKEAWSYNLTIGCTSNELVQDQLSLFDVMSSELMNHKLPYMIGQENYVEELR
SESLVSLYREYILLRLSNYKPQLFTVNHVEFSYIRGSRDKNSWFALPDFRLRDRGGRSVW
LKILGITKSLLTYFALNRKNENYSLLFKRRKCDSDIPSILRISDDMDTFLIHLLEENSSH
EFEVLGLQLCSFYGTLQDFTKSFAEQLKELLFSKFEKIQCFNWVCFSFIPLLSQKECELS
NGDMARLFKVCLPLVKSNESCQLSCLLLANSIKFSKQLLSDEKTINQIYDLYELSDILGP
ILVTNESFMLWGYLQYVGKDFQSMNGISSADRIFEWLKSKWNQLRGTDAKQDQFCNFISW
LGNKYDPENPFNDKKGEGANPVSLCWDESHKIWQHFQEQREFLLGVKPEEKSECFNTPFF
NLPKVSLDLTRYNEILYRLLENIESDAFSSPLQKFTWVAKLIQIVDNLCGDSTFSEFIAA
YKRTTLITIPQLSFDSQNSYQSFFEEVLSIRTINVDHLVLDKINMKEIVNDFIRMQKNKS
QTGTSAINYFEASSEDTTQNNSPYTIGGRFQKPLHSTIDKAVRAYLWSSRNKSISERLVA
ILEFSDCVSTDVFISYLGTVCQWLKQAIGEKSSYNKILEEFTEVLGEKLLCNHYSSSNQA
MLLLTSYIEAIRPQWLSYPEQPLNSDCNDILDWIISRFEDNSFTGVAPTVNLSMLLLSLL
QNHDLSHGSIRGGKQRVFATFIKCLQKLDSSNIINIMNSISSYMAQVSYKNQSIIFYEIK
SLFGPPQQSIEKSAFYSLAMSMLSLVSYPSLVFSLEDMMTYSGFNHTRAFIQQALNKITV
AFRYQNLTELFEYCKFDLIMYWFNRTKVPTSKLEKEWDISLFGFADIHEFLGRYFVEISA
IYFSQGFNQKWILDMLHAITGNGDAYLVDNSYYLCIPLAFISGGVNELIFDILPQISGKT
TVKYHKKYRLLMLKWIIRFTDLGSLTELRSTVEKLFPTSYLSPYLFENSSVSMRYQYPLH
IPLALGATLVQTQFAHEKNNTHEFKLLFLSVITDLEKTSTYIGKLRCARELKYLFVLYEN
VLVKSSTLNFIIIRLSKFLIDTQIHDEVITIFSSLLNLADKNTFEIEPSLPNLFCKIFIY
LRENKQLSPSFQQAIKLLEHRDLIKIKTWKYCLDAIFGNIVQDDIYENTELLDASDCGVD
DVVLVSLLFSYARRPVASKIGCSLSKAAAINILKHHVPKEYLSKNFKLWFAALSRRILQQ
EVQRERSTNFNNEVHLKNFEMVFRHPEQPHMIYQRISTFNKEAELYDSTEVFFISECILT
YLVGYSIGNSESEFCFRDNIMNENKDKVAPLDKDVLNAIYPLANNFGMESFICDTYLSVN
EPYNCWLSKFARSLIHQISFNIPPIVCLYPLCKGSTAFCELVLTDLFFLSTTYDPKSCLN
WSNRIFTQIAMLLHVKDSEIKLKMLFNVIKMIRMGSRCKERNCLRIYSSLDLQEICQISL
KIKEFKFGYLLFEEMNMPNIREMNINTLQKIYECINDGDFLAGLPVPHSIEGVLNSINRI
DSDTWKRFLFNNADFDANYTTSLEEEKESLIKATEDSGFYGLTSLLESRLSGSSDVYKWN
LELGDWKLLTPKVVDSKAKGLYYAIKNLPQDVGFAEKSLEKSLLTIFDSRQHFISQTEWM
DTLNAIIEFIKIAAIPQDVTSFPQTLMSIMKADKERLNTIDFYDHKTTLKSRHTLMNVLS
RNSLDENVKCSKYLRLGSIIQLANYVQLAIANGAPQDALRNATLMSKTVKNIAKLYDDPS
VVSQIEKLASFTSANALWESREYKAPVMIMRDLLAQNEKNISESILYDDFKLLINVPMDQ
IKARLVKWSSESRLEPAAAIYEKIIVNWDINVEDHESCSDVFYTLGSFLDEQAQKLRSNG
EIEDREHRSYTGKSTLKALELIYKNTKLPENERKDAKRHYNRVLLQYNRDSEVLKALLLQ
KEKFLWHALHFYLNTLVFSNRYDNDIIDKFCGLWFENDDNSKINQLLYKEIGTIPSWKFL
PWVNQIASKISMEENEFQKPLQLTMKRLLYKLPYDSLYSVMSILLYEKQSNKDTNISQKI
QAVKKILLELQGYDRGAFAKKYLLPVQEFCEMSVELANLKFVQNTKTLRLANLKIGQYWL
KQLNMEKLPLPTSNFTVKSSADGRKARPYIVSVNETVGITTTGLSLPKIVTFNISDGTTQ
KALMKGSNDDLRQDAIMEQVFQQVNKVLQNDKVLRNLDLGIRTYKVVPLGPKAGIIEFVA
NSTSLHQILSKLHTNDKITFDQARKGMKAVQTKSNEERLKAYLKITNEIKPQLRNFFFDS
FPDPLDWFEAKKTYTKGVAASSIVGYILGLGDRHLNNILLDCSTGEPIHIDLGIAFDQGK
LLPIPELVPFRLTRDIVDGFGVTGVDGLFRRSCERVYAVLRKDYVKVMCVLNILKWDPLY
SWVMSPVKKYEHLFEEEHEITNFDNVSKFISNNDRNENQESYRALKGVEEKLMGNGLSVE
SSVQDLIQQATDPSNLSVIYMGWSPFY
NT seq 8364 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcatgggattgtagaaactttaaactttctatcatcaacaaaaatcaaagag
agaaacaatgctttagatgagctaacaacaattttaaaagaagatccggaaaggatacca
accaaggccctatctacaacggcagaagctttggtagagttacttgcatctgaacacaca
aaatactgtgaccttcttcgaaacttgacagtgtcaaccacaaacaagctatcacttagt
gagaacagactctccacgatatcgtacgttttaagattatttgtagaaaaatcatgtgag
agatttaaagtgaaaacgttgaagttacttttagcagtagtacctgaattaatggtcaaa
gatggttccaaaagtttattggatgccgtttcagtacatttatcgtttgctttggatgcc
ctaattaaaagtgaccctttcaaactgaaattcatgatacaccaatggatatccttagtc
gataaaatttgcgagtactttcaaagccaaatgaaattatctatggtagacaaaacattg
accaatttcatatcgatcctcctgaatttattggcgttagacacagttggtatatttcaa
gtgacaaggacaattacttggaccgtaatagattttttgaggctcagcaaaaaagaaaat
ggaaatacgagattaataatgtcattaataaatcaattaattttgaagtgccattgtttt
agtgttattgatacgctaatgcttataaaagaagcatggagttacaacctgacaattggc
tgtacttccaatgagctagtacaagaccaattatcactgtttgatgttatgtcaagtgaa
ctaatgaaccataaacttccttatatgattggtcaagagaattatgttgaagagcttcgg
tccgaatctcttgtatctctataccgtgagtacattctactgcgcttaagtaattataag
cctcaattatttaccgtaaaccatgtggaattctcatatattcgaggttcaagggataaa
aattcatggtttgcattacctgattttagacttagagataggggaggcagatcggtgtgg
ttaaaaatactcggaattaccaaatcattgttaacatattttgcattgaacagaaaaaat
gaaaattactcattattatttaaaagaagaaaatgtgattcggatataccttctatccta
cggatttctgacgatatggacacatttcttattcatcttttagaggagaacagctcacat
gagtttgaagtgctaggattacaattgtgctcattttatggaactttacaagacttcact
aaaagttttgcagaacagctgaaagaacttctgttttcaaaattcgaaaaaatccaatgc
tttaattgggtttgtttttcttttattcctttattatcccaaaaagaatgcgaattaagc
aatggcgacatggcacgcctatttaaagtttgcttaccattagtaaaatcaaatgaatct
tgccagttaagttgtcttttattagccaactccataaagttttcaaagcagcttttatcc
gatgagaaaactatcaatcagatatatgatctttacgaattatccgatattttgggtccc
atattagttactaatgaatcgttcatgctatggggataccttcagtacgttggtaaagac
ttccaatctatgaacggtatatcgtccgctgatagaatttttgagtggctaaaatcaaag
tggaaccagttgcgcggaactgatgctaaacaggatcagttctgcaattttatatcctgg
ttaggtaacaaatatgacccagagaaccctttcaacgataaaaaaggcgaaggagctaat
cctgtctcactatgttgggatgaaagccacaagatttggcaacattttcaagagcagagg
gaatttcttttaggcgtaaaaccagaagaaaagtcagaatgttttaacactccctttttt
aatttaccaaaagtttccttagacctcacacgttataatgaaattctttacagattactg
gaaaatattgaaagtgatgcattttcatctccactacaaaaatttacttgggtagcaaaa
ttaatacaaatagttgataatctttgtggagattccactttttctgagtttattgcagca
tataagagaacaaccttaataactattccacaacttagttttgatagccaaaactcctac
caatcattttttgaggaggttttatcgatacggaccataaatgtagaccatttagtgctt
gacaaaattaatatgaaggaaatcgttaatgattttatcaggatgcaaaaaaacaaatct
caaacaggaacttctgccatcaattacttcgaagcctcttcagaagacactacccagaat
aatagtccgtacacaattggaggtagatttcagaagcctctgcactccactatagataaa
gcagtgcgagcttacctatggtcttcaagaaataaatccatttcagagcgtttggtagcc
atattggaattttctgattgcgttagcacagatgtatttatatcttatcttggcactgtt
tgccagtggttaaaacaagcaatcggggagaaatcttcttacaacaaaatcctggaagaa
ttcactgaagtcttgggtgaaaaattgctttgcaaccactatagttcttccaatcaagct
atgcttttacttacatcttatatcgaagcaataagacctcaatggttatcttaccccgag
cagcctttgaattcggactgcaatgatatcctggactggatcatatctagatttgaggac
aattctttcactggtgtggcccctacggtcaacctttctatgctgctgcttagcctactt
caaaatcatgatctttcccacggatcaatcagaggtgggaagcagagagtctttgcaact
tttattaaatgcctgcaaaagctagactcctccaatattattaacataatgaacagtatt
tcgagttatatggcccaagtgagctataagaatcaaagtatcatattttatgagattaag
agcttatttggtccgcctcagcaaagtattgaaaagtccgctttctactctcttgcaatg
tccatgttgtctttggtgtcttacccaagcttagttttttctttggaggatatgatgaca
tactctggcttcaatcatactcgtgcgtttatccaacaagctctgaacaaaattacggtc
gcttttcgctaccaaaaccttacagagctcttcgaatattgtaagtttgatttgattatg
tactggtttaacagaacaaaagtccctacttctaaattggagaaagaatgggatatatct
ctttttggatttgccgatattcatgaatttttaggaagatactttgtagaaatttctgca
atctacttttctcaaggtttcaaccaaaaatggatcttagacatgttacacgcgattact
ggaaacggtgatgcttatctggtggataacagctattacttgtgtattccacttgccttt
atcagtggcggtgtgaatgaactaatatttgatatattgccccaaatatcaggtaaaaca
acagtaaaataccataaaaaataccgtctactgatgttaaagtggatcataagatttact
gatttgggctcacttactgaacttagatctactgttgaaaaattattcccaacttcatac
ctttcgccatatttatttgaaaattccagtgtttcaatgaggtatcaatacccacttcat
atacccttggcattaggagcaaccttagttcagacgcagtttgctcatgaaaagaacaac
acacacgaattcaagcttttgtttttatcggttattacagaccttgaaaagacatcgact
tacataggaaaactgcgatgtgcaagggagttaaaatatctttttgtgttgtatgagaat
gtacttgtaaaatcatcaactttaaacttcatcataattcggctttcaaaattcttaata
gatacacaaattcacgatgaagtaataacaattttcagctcattgttaaatctggctgac
aaaaatacgtttgaaatagagccatctctgcccaatttattttgcaaaatattcatttat
ttgagggaaaacaaacagctcagtccatccttccagcaggctataaagcttttagagcat
cgggatctcatcaaaataaaaacttggaaatactgccttgatgcaatattcggaaatata
gtccaagatgatatttatgaaaatacggaacttttggatgctagtgattgtggcgtagac
gatgttgtattggtttctttactcttttcttatgccaggagaccggtagcttcaaaaatc
ggttgttcgctttctaaagctgctgcaattaacattttgaaacaccatgttccaaaggaa
tatttgagtaaaaacttcaaactatggttcgctgctctttcaagaagaattttacagcaa
gaagttcaaagagagagatctacaaactttaataatgaagttcatttgaaaaactttgaa
atggtatttcgccatcccgaacaaccacatatgatataccaacgtatttcgaccttcaat
aaagaagctgagttatatgattctactgaagtgttttttatttctgagtgcattctaacg
tacctagtgggctactcaataggaaatagcgaaagtgaattttgttttagggataacata
atgaacgagaacaaagataaagttgctccattggacaaggatgtactgaatgctatatac
ccgttggcaaacaattttgggatggaatcattcatatgcgatacttatttgtcagtgaac
gaaccctacaactgctggctaagcaaattcgcccgtagtttgattcaccaaatatcattt
aatatacctcctattgtttgcttgtatcctttatgcaaaggatcaacagctttttgtgaa
ttagtacttactgacctcttttttctttcaacgacttacgatccgaaaagctgtttgaat
tggagcaatcgaatattcactcaaatagcaatgttgctgcatgttaaagattctgagata
aagctaaagatgcttttcaatgtaattaaaatgattaggatgggttctagatgcaaggaa
cgaaactgtctgcgcatatattctagcttagatttacaagaaatatgtcaaatttctctt
aaaataaaagagttcaagtttggctatttgttatttgaggaaatgaacatgccaaacata
agagaaatgaatataaatacacttcagaagatttacgaatgcataaatgacggcgatttt
ctagcaggcttacctgttccacactcaatagagggtgttttgaactctatcaatagaatt
gactcagatacgtggaaacgttttcttttcaacaacgccgattttgatgccaattacact
acttcactagaagaggaaaaggaatcattaatcaaggccacagaagatagcggtttctac
gggttgacaagcttattggaaagtagactttctggatccagtgatgtctacaaatggaat
ttagaattgggagactggaagctattgactccaaaagttgttgattccaaagccaaaggt
ttatactatgccataaaaaatttaccacaggacgttggttttgctgaaaaaagtttagaa
aaatccttattaactatttttgattctcgacaacattttattagccaaactgaatggatg
gatactctgaacgcgattattgaatttataaaaatagcagcaatccctcaggacgttact
tccttcccccaaacattgatgtctattatgaaggccgataaggagagacttaatacaata
gacttctatgatcacaaaacaacgttaaagagtagacatactttaatgaatgtgctctcg
aggaattcattagatgaaaacgtaaaatgctcgaaatatttacgccttggatccattatt
cagcttgctaattacgttcagctggcaattgccaatggtgcgcctcaagatgcgttacga
aatgccactctaatgagcaaaacagtgaagaatattgcaaaattatacgatgatccctct
gtagtatctcaaattgagaaattggcaagtttcacatctgctaatgccctctgggagtct
cgagagtacaaggcacctgtaatgataatgagagatcttttagctcaaaatgagaagaat
attagcgaaagtatcctttatgacgattttaagctactcattaatgtgcctatggaccaa
attaaagctcgactagttaaatggagctcagaatcaaggcttgaaccagctgctgcaata
tatgaaaaaatcattgtcaattgggatataaatgtcgaagatcatgaatcatgttctgat
gttttctacacactcggaagttttctggatgaacaggcacaaaagttacgatcaaatgga
gaaatcgaagatagagaacataggtcatatactggaaaatctaccttgaaagctttggag
ctgatatataaaaacacaaaattaccagaaaatgaaagaaaagatgcgaaaaggcattat
aatcgtgtcttgctacaatataatagagattctgaagtactaaaggcactgcttcttcaa
aaagaaaaatttttatggcatgcactccatttctatctcaataccttagttttcagcaac
agatatgataatgacattattgataagttttgtggtttatggttcgagaatgatgacaat
agcaagatcaatcaattactatataaagaaattggaacaataccgagctggaagtttttg
ccctgggtcaatcagattgcgtcaaaaatatctatggaggagaatgaatttcaaaagcca
ttgcaactaaccatgaaacgacttctttacaaactaccgtatgactccctttattcagtg
atgagcatactactatatgaaaagcaatccaataaggacaccaacatatcccaaaaaatt
caagctgtcaaaaagattcttttagaattgcaaggatatgacaggggtgcctttgcgaaa
aagtatttacttcctgtgcaagagttttgcgagatgtctgtagagttagctaatcttaag
tttgtgcaaaatacgaagacgttacgcttagctaatttgaagattggccaatattggctg
aaacagctaaacatggagaagcttcccctaccgaccagtaattttacagtcaaaagttct
gctgatggaagaaaagcccgcccttatattgtatccgtcaatgaaacagtaggcattact
accacaggattgtccctgccgaaaatagtcaccttcaacatctcagatggtacaacgcag
aaagctttgatgaaaggaagtaatgacgatttgagacaagatgcaattatggaacaagtg
tttcaacaagttaataaagttctacaaaatgataaagtattaagaaatctagatctgggt
attagaacatacaaagtggttccattaggaccaaaggcaggaatcattgaatttgtcgca
aattctacatcattacatcaaattttgagtaagctacataccaacgataagataaccttc
gatcaggcaagaaaaggcatgaaagcagttcaaacaaaatcaaatgaagagaggctgaaa
gcttatttaaaaatcactaatgaaataaaaccgcagttaagaaactttttttttgattcc
tttcccgatccgttggattggtttgaagctaagaaaacgtacacaaaaggtgtcgcagct
agctctatcgttggatacatattaggcctcggtgataggcacttaaacaatatcctgctt
gactgctcaacaggggagcctattcatatagacctgggaattgcgtttgatcagggaaaa
ttactccccattccagagttggtccctttcagattaactagagatatcgttgatggattt
ggagtcacaggcgtggatggcctattcaggcggagttgtgaaagagtttacgcagtatta
agaaaagattatgtcaaggtgatgtgtgttttgaatatcttaaaatgggatcccctttat
tcctgggtaatgtcaccagttaaaaaatacgaacacttatttgaagaagaacatgaaatt
acaaatttcgataacgtcagcaagttcataagtaacaacgacaggaacgaaaaccaagag
tcttatagggcccttaaaggtgtagaagagaagcttatgggtaatggactaagtgtagag
tctagcgtacaagatttgattcagcaagccacggatccatcaaatttgagtgttatatat
atgggatggtcacctttttattaa

DBGET integrated database retrieval system