KEGG   Saccharomyces cerevisiae (budding yeast): YBL097WHelp
Entry
YBL097W           CDS       T00005                                 

Gene name
BRN1
Definition
(RefSeq) condensin subunit BRN1
  KO
K06676  condensin complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YBL097W (BRN1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Condensin I
    YBL097W (BRN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cnd2 CNDH2_N AKAP95
Motif
Other DBs
NCBI-GeneID: 852180
NCBI-ProteinID: NP_009455
SGD: S000000193
UniProt: P38170
Structure
PDB: 

Position
II:40831..43095
Genome map
AA seq 754 aa AA seqDB search
MTTQLRYENNDDDERVEYNLFTNRSTMMANFEEWIKMATDNKINSRNSWNFALIDYFYDL
DVLKDGENNINFQKASATLDGCIKIYSSRVDSVTTETGKLLSGLAQRKTNGASNGDDSNG
GNGEGLGGDSDEANIEIDPLTGMPISNDPDVNNTRRRVYNRVLETTLVEFETIKMKELDQ
ELIIDPLFKKALVDFDEGGAKSLLLNTLNIDNTARVIFDASIKDTQNVGQGKLQRKEEEL
IERDSLVDDENEPSQSLISTRNDSTVNDSVISAPSMEDEILSLGMDFIKFDQIAVCEISG
SIEQLRNVVEDINQAKDFIENVNNRFDNFLTEEELQAAVPDNAEDDSDGFDMGMQQELCY
PDENHDNTSHDEQDDDNVNSTTGSIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANLVN
KESDLLEETRTTIGDTTDKNTTDDKSMDTKKKHKQKKVLEIDFFKTDDSFEDKVFASKGR
TKIDMPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFSHRKHTRGDVSSGLFEK
STVSANHSNNDIPTIADEHFWADNYERKEQEEKEKEQSKEVGDVVGGALDNPFEDDMDGV
DFNQAFEGTDDNEEASVKLDLQDDEDHKFPIRENKVTYSRVSKKVDVRRLKKNVWRSINN
LIQEHDSRKNREQSSNDSETHTEDESTKELKFSDIIQGISKMYSDDTLKDISTSFCFICL
LHLANEHGLQITHTENYNDLIVNYEDLATTQAAS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaactaaggtatgaaaataacgatgacgatgaaagagtagaatataatctc
tttaccaatagatccaccatgatggcaaattttgaagaatggatcaaaatggctacagat
aataaaatcaattcccgaaatagttggaatttcgcattgatcgactatttttatgacttg
gacgttttgaaagatggcgagaataacatcaattttcagaaagcatctgcaaccttggat
gggtgtattaagatttactcttcgagagttgattcagtgacaacggaaacaggtaagtta
ttgagcgggttggcacaaagaaagacgaatggggcatctaacggagatgacagtaacggg
ggaaatggtgaagggcttggaggtgacagtgacgaagcaaatatagagattgatccctta
actggtatgcctatatctaatgatcctgatgtgaataacactaggcggagagtgtacaac
agagttttagaaacaacattggtggagttcgaaacgatcaagatgaaagagctagaccag
gaattaataattgatccattattcaaaaaggccttggttgatttcgatgaaggtggcgcc
aagagtttattgttgaacacattaaacatagacaacactgcaagagtcattttcgatgca
tcaattaaggatacacaaaacgtagggcaaggtaaacttcaaaggaaagaagaagaatta
attgaaagagatagtttagtagatgacgaaaatgaacctagccagtcattgataagtact
cgtaatgactcaaccgtaaatgattccgttattagtgcaccttccatggaagatgagatt
ttatctcttggtatggattttataaaatttgatcaaattgcggtgtgtgaaatttcagga
tcgattgagcaactaaggaacgttgtcgaagatattaatcaagcgaaagactttatcgaa
aatgttaacaacagatttgataacttcttaactgaagaagaattgcaagcagctgtccca
gataatgcagaagatgatagcgatggctttgatatgggcatgcaacaggagctgtgctat
ccagatgaaaatcatgacaatacatcacatgatgaacaagatgatgataatgtcaacagt
accacaggaagtatattcgaaaaagatttgatggcatactttgacgaaaatctaaataga
aactggagagggagagaacattggaaagtacgaaattttaagaaagcaaacttagtgaat
aaagaatccgacctgttggaagaaacgcgaactactataggagatactactgacaaaaac
acaacggacgacaaatcgatggatacgaagaagaagcataaacaaaaaaaggttctggaa
attgatttcttcaaaacggatgatagttttgaagacaaagtctttgcctcaaaaggaagg
acaaagattgacatgccgattaagaacagaaagaacgacacacattatttactgccggat
gacttccatttttccactgatagaataacaagattgttcattaaaccggggcagaaaatg
agtctgttcagtcataggaagcataccagaggcgacgttagttcggggctttttgaaaaa
agcacagtttctgccaaccattcaaataacgacattcctactattgcagatgagcacttt
tgggcggataattacgaaaggaaagaacaagaggaaaaagaaaaggagcagtctaaagag
gttggtgatgtggtgggtggagcgctcgataatccgtttgaagatgacatggacggtgtt
gacttcaaccaagctttcgaaggaacagatgataacgaggaggccagtgtgaaacttgat
ttacaggatgacgaagatcataagttccccattcgagaaaataaagttacttattcaaga
gtttcgaaaaaagttgacgtaagaagattaaagaaaaacgtatggagatcgatcaacaat
ttgatacaagaacatgacagtaggaaaaatagagaacaaagctctaatgacagtgaaacc
cacacagaagatgaatcaacaaaggagctcaagttttctgatatcattcagggtataagt
aaaatgtattcggatgatacactaaaggacatttcaacaagcttttgttttatatgcctt
ctacacttagccaatgagcatgggttgcagataactcataccgaaaactataatgacttg
atagtgaattatgaggatctagcgacaacacaggcagcgtcatag

DBGET integrated database retrieval system