KEGG   Saccharomyces cerevisiae (budding yeast): YBL105CHelp
Entry
YBL105C           CDS       T00005                                 

Gene name
PKC1, CLY15, CLY5, CLY7, HPO2, STT1
Definition
(RefSeq) protein kinase C
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04070  Phosphatidylinositol signaling system
sce04139  Mitophagy - yeast
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBL105C (PKC1)
   04070 Phosphatidylinositol signaling system
    YBL105C (PKC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YBL105C (PKC1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    YBL105C (PKC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YBL105C (PKC1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YBL105C (PKC1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     YBL105C (PKC1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   YBL105C (PKC1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    YBL105C (PKC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 HR1 Pkinase_C C2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 852169
NCBI-ProteinID: NP_009445
SGD: S000000201
UniProt: P24583
Position
II:complement(14241..17696)
Genome map
AA seq 1151 aa AA seqDB search
MSFSQLEQNIKKKIAVEENIIRGASALKKKTSNVMVIQKCNTNIREARQNLEYLEDSLKK
LRLKTAQQSQGENGSEDNERCNSKEYGFLSTKSPNEHIFSRLDLVKYDCPSLAQRIQYML
QQLEFKLQVEKQYQEANTKLTKLYQIDGDQRSSSAAEGGAMESKYRIQMLNKALKKYQAI
NVDFDQFKHQPNDIMDNQQPKFRRKQLTGVLTIGITAARDVDHIQSPMFARKPESYVTIK
IDDTIKARTKPSRNDRWSEDFQIPVEKGNEIEITVYDKVNDSLIPVAIMWLLLSDIAEEI
RKKKAGQTNEQQGWVNASNINGGSSLASEEGSTLTSTYSNSAIQSTSAKNVQGENTSTSQ
ISTNSWFVLEPSGQILLTLGFHKSSQIERKQLMGGLHRHGAIINRKEEIFEQHGHHFVQK
SFYNIMCCAYCGDFLRYTGFQCQDCKFLCHKKCYTNVVTKCIAKTSTDTDPDEAKLNHRI
PHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCHAQCAHLVPDFCGMSMEMANK
ILKTIQDTKRNQEKKKRTVPSAQLGSSIGTANGSDLSPSKLAERANAPLPPQPRKHDKTP
SPQKVGRDSPTKQHDPIIDKRISLQTHGREKLNKFIDENEAYLNFTEGAQQTAEFSSPEK
TLDPTSNRRSLGLTDLSIEHSQTWESKDDLMRDELELWKAQREEMELEIKQDSGEIQEDL
EVDHIDLETKQKLDWENKNDFREADLTIDSTHTNPFRDMNSETFQIEQDHASKEVLQETV
SLAPTSTHASRTTDQQSPQKSQTSTSAKHKKRAAKRRKVSLDNFVLLKVLGKGNFGKVIL
SKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRI
YFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPE
GHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLC
QSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEE
PFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPLPSVLTTSQQEEFR
GFSFMPDDLDL
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcacaattggagcagaacattaaaaaaaagatagccgtcgaagaaaatatt
attcggggagcttctgccctcaagaaaaagactagcaatgttatggtcattcagaaatgt
aatacgaatattagagaggcacgtcaaaatcttgagtacttggaggatagcttaaaaaaa
ttacggttgaagaccgctcaacaaagtcagggtgaaaatggcagcgaagataatgagcga
tgcaattcgaaggaatacgggtttctttctaccaaatcgccaaatgaacacatattttct
cgtttggatttagtaaaatatgattgcccttctttggcgcaaagaatccaatacatgttg
caacaattagaattcaaattacaggtggaaaagcaataccaagaagccaatactaaattg
actaaattgtatcaaattgacggtgatcaacgtagtagttctgcggcagaagggggtgct
atggaatccaaatacaggattcaaatgcttaacaaagctttgaagaaataccaagctatt
aacgttgactttgatcaatttaaacaccaacccaatgacataatggataatcaacaaccg
aaattccgaagaaaacaactgactggcgttctaacaattggaataactgctgctagagat
gttgaccatatacaatcaccgatgtttgccaggaagccagagagctacgttactataaaa
atcgatgatacgatcaaagccagaacgaagccttctagaaatgacaggtggagtgaagat
tttcaaattccagttgaaaaagggaatgaaatcgagattactgtatatgataaggtgaac
gactcgctcattccagtggctataatgtggttactgctttccgatatcgctgaagaaatt
cgtaagaagaaagccggacaaacaaatgaacaacaaggatgggtcaacgcttcaaacatt
aatggtggttcttctctcgctagcgaagagggaagcacattgacttctacatactcaaac
tcagccattcagtctacttcagcaaagaatgtgcaaggcgaaaatacatcaactagtcaa
atcagtacgaattcatggtttgtcttagaaccatccgggcagattttgttaacactagga
ttccacaagtcttctcaaatagaaaggaagcagttgatgggtggactacatcgtcatggt
gctattatcaataggaaagaagagatattcgaacagcatggccaccactttgtacaaaaa
tcattttacaacattatgtgctgtgcatattgtggtgatttccttcggtatactgggttc
caatgtcaagattgtaaatttttatgtcacaaaaaatgttacaccaatgttgttactaag
tgtattgctaaaacttctactgatacggatccggacgaggcaaagttgaaccaccgtatt
cctcatagattcctgcctacttcaaaccgtggtactaaatggtgctgtcactgtggttat
attttaccatggggtagacataaagtacgcaaatgttctgaatgtggtataatgtgtcat
gctcaatgtgctcatttggttcccgatttctgtggcatgtcgatggaaatggctaataaa
attctgaaaacgattcaagacacaaaacgtaatcaagagaaaaagaagaggacagttccg
tcggcacagttggggtcatctattggtactgccaatggtagtgatctttccccatccaaa
ttagctgaaagggcaaacgctcctttgcctcctcagccaagaaaacatgataaaactcct
tcgcctcagaaggtaggaagagattctccaactaagcagcatgatcctattattgataaa
agaatttcactacaaacgcacgggcgtgagaaactaaataaatttatcgatgaaaatgag
gcctatttaaattttacagaaggtgcacaacaaaccgccgaattttcatcaccagagaaa
acactggatccaacgtcgaatagacgttccttgggactcactgatttatctattgagcat
agtcaaacttgggaatctaaagatgatttaatgagagatgaacttgaactgtggaaagca
caacgtgaggaaatggaacttgaaataaaacaagatagtggggaaatccaagaggatcta
gaagttgatcacattgatttagagaccaaacagaaactagactgggagaacaaaaatgat
ttccgtgaagctgatttgacaatagattccacacacacaaatccattccgcgatatgaat
agtgaaacctttcaaattgaacaagaccatgcttcaaaggaagtactacaagaaacagtg
tccttggctcctacaagtactcatgcctccagaaccactgatcaacaatctccgcagaaa
tcacaaaccagcacaagcgcaaagcataaaaagagagcggctaaacgtcgtaaggtttca
ttagataatttcgtattactcaaagttcttggtaaaggtaattttggtaaagttatttta
tctaaatcaaagaatactgacaggctttgtgccataaaagttctgaagaaagataatatt
attcaaaatcatgacatcgagagtgcaagagcagaaaagaaagtatttttgttagccaca
aaaactaaacacccattcttaaccaatctatactgctcttttcaaactgaaaaccgtata
tattttgctatggagtttattgggggcggtgacttaatgtggcatgttcaaaaccaaaga
ctatctgtaagaagggccaaattttatgccgccgaggtcttactggctctgaaatatttt
catgataatggtgtaatataccgtgatttgaagttggaaaacattctattaactccagaa
ggtcatataaaaattgccgattatggtttgtgtaaagatgaaatgtggtatggtaataga
acttctacattttgtggcacaccagaatttatggctccagaaattttaaaagagcaagaa
tataccaaagctgtcgattggtgggcatttggggtgctgctatatcaaatgctactgtgc
caatctccattctcaggagatgacgaagatgaagtttttaacgctatccttaccgatgaa
cccttatacccaatagatatggcaggtgagattgtacaaatattccaaggcctattaaca
aaagatcctgaaaagaggttgggtgctggtcccagggacgcagacgaagttatggaagaa
cctttcttccgtaacatcaactttgacgatatcttaaaccttcgcgtgaaaccaccctac
atcccagaaattaaatctccggaagatacatcatatttcgagcaagaattcacctctgcg
ccacccacacttacacctctgccctctgttttgacaacgagccagcaagaagagtttaga
ggattttcctttatgccagatgatttggatttatga

DBGET integrated database retrieval system