KEGG   Saccharomyces cerevisiae (budding yeast): YBR005W
Entry
YBR005W           CDS       T00005                                 

Gene name
RCR1, SSH6
Definition
(RefSeq) Rcr1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: RCR SARAF DUF2207 Stevor LapA_dom DUF4381
Other DBs
NCBI-GeneID: 852290
NCBI-ProteinID: NP_009559
SGD: S000000209
UniProt: P38212
Position
II:245906..246547
AA seq 213 aa
MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTF
VANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYD
QRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVP
AVSDTVEQLERLPGGTTTQEINPPERAKVNARS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgggacttatttcatacgaaaatgaggcgataaacgaggtgaaaaaggcagataaccat
cacgttagcaaatttgtgactagttactatgggccatcatcgtcgtcatggcagtcagga
atatggattttgtttgtgctgtttgttgccgcagtaatccttataatactgttcactttt
gtagcgaacagaaggagacgaaggatggggcgtgctcccattagaggtacggcatggttg
acaccgccttcatacagacagtctcagcaacaatatactgggaccgttcagcaacggaca
gatgattatgttcctgagtatacagaaacagcgaacgaacatgatcttggatactatgac
cagcggggcgagtttcaccccaacgataaggctgcatacgtggcccccccgccattggta
caagaatgttcatcagaatctgttaattctttagaaagacctcccgctgctgtagttcac
caagctaactctttagatacggattacggtttaacaaggcctagcaatgggcgcgttcca
gctgtaagtgatacggtggagcaattggaaaggcttccgggcgggactacaacgcaggaa
attaacccaccggagagggcaaaggtaaatgcaaggtcatga

DBGET integrated database retrieval system